close all open/close all

CDS information : MUP_00380


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction78,924 / 78,019 / - [in whole cluster]
78,924 / 78,019 / - [in contig]
Locationcomplement(78019..78924) [in whole cluster]
complement(78019..78924) [in contig]
TypeCDS
Length906 bp (301 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)possible thioesterase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP038c, -, len: 301 aa. Possible thioesterase, similar to AAO65353|Q84CJ0 LanU-like protein from Streptomyces murayamaensis (249 aa), fasta scores: opt: 558, E(): 6.4e-30, (37.945% identity in 253 aa overlap); and weakly similar to weakly similar to Q98NH0 Lactone-specific esterase from Rhizobium loti (Mesorhizobium loti) (334 aa), fasta scores: opt: 175, E(): 0.00037, (23.675% identity in 283 aa overlap); Q9CD03|ML2603 Hypothetical protein from M. leprae (279 aa), fasta scores: opt: 153, E(): 0.0099, (33.051% identity in 118 aa overlap); Q9XAK3|SCO3599 Hypothetical protein from Streptomyces coelicolor (318 aa), fasta scores: opt: 160, E(): 0.0037, (28.261% identity in 276 aa overlap); and Q8PQF3 Hydrolase from Xanthomonas axonopodis (280 aa), fasta scores: opt: 158, E(): 0.0045, (30.769% identity in 130 aa overlap). Contains potential match to Pfam PF02230 Phospholipase/Carboxylesterase, Pfam PF00561 alpha/beta hydrolase fold.
Reference
ACC
PmId
[14736915] Giant plasmid-encoded polyketide synthases produce the macrolide toxin of Mycobacterium ulcerans. (Proc Natl Acad Sci U S A. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [possible thioesterase]
MIVWPEVVSTVVDVDGVAMSALVAEPDQEPKAVILALHGGATNARYFDCPGHRALSLLHT
GAAAGFTVVALDRPGYGSSAGDPDAMNRPHQRAALAYGALDRILAQRPRGAGVFIMGHSN
GCELAMWMATETRGAELLGIELAGTGWHYQPEAREILTTATGEHRWVGLYDLLWHPQRLY
PPEVLNAAIISSSAPAYEEQMMADWTRRTFLELVPAVRVPVHFSIAQHEKVWQRDSSALD
EIAVLFSGAPRFILHEQPEAGHNISLGHTAGDYHTTVLSFVQQCLAERLANAQQDVDLAA
E
selected fasta
>hypothetical protein [possible thioesterase]
ATGATTGTTTGGCCCGAAGTGGTCAGCACAGTGGTCGACGTCGATGGCGTGGCGATGTCG
GCACTAGTCGCCGAACCCGATCAGGAGCCTAAGGCCGTGATCTTAGCCCTGCATGGCGGT
GCCACCAACGCGCGGTATTTCGACTGCCCTGGCCACCGCGCGCTTTCCCTGCTGCACACC
GGCGCGGCGGCGGGATTCACCGTTGTGGCCCTTGACCGGCCCGGCTACGGCAGCTCGGCG
GGTGATCCCGACGCGATGAACCGGCCCCACCAGCGGGCCGCGCTGGCCTATGGGGCGCTG
GATCGCATCCTGGCGCAGCGGCCACGCGGGGCCGGGGTGTTCATAATGGGCCATTCAAAC
GGATGCGAACTGGCGATGTGGATGGCCACCGAGACGCGCGGTGCCGAGCTGCTCGGCATC
GAGTTGGCTGGTACCGGCTGGCATTATCAGCCCGAGGCCCGAGAAATCCTGACAACGGCC
ACTGGTGAACATCGGTGGGTGGGCCTCTATGATTTGCTCTGGCATCCGCAGCGGCTATAC
CCGCCCGAGGTCCTCAACGCGGCCATCATTTCTTCGTCCGCCCCGGCCTACGAGGAGCAG
ATGATGGCCGACTGGACCCGCCGAACCTTCCTGGAGCTAGTCCCTGCTGTGCGTGTGCCG
GTACATTTCAGCATCGCCCAACACGAAAAGGTTTGGCAGCGCGATAGTTCAGCGCTAGAT
GAAATCGCCGTCCTGTTCTCTGGCGCGCCGCGGTTCATCCTGCATGAACAACCCGAGGCC
GGACACAACATCAGCCTGGGCCACACCGCCGGCGACTACCACACGACAGTCCTGTCGTTT
GTCCAGCAATGTCTGGCCGAACGGTTGGCCAACGCGCAACAAGATGTCGATCTCGCGGCC
GAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit