close all open/close all

CDS information : MUP_00390


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction86,312 / 79,080 / - [in whole cluster]
86,312 / 79,080 / - [in contig]
Locationcomplement(79080..86312) [in whole cluster]
complement(79080..86312) [in contig]
TypeCDS
Length7,233 bp (2,410 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)Type I modular polyketide synthase
Gene
Gene (GenBank)mlsA2
EC number
Keyword
Note
Note (GenBank)
  • MUP039c, mlsA2, len: 2410 aa. Type I modular polyketide synthase, composed of one extender module (module 9); required for the synthesis of the mycolactone core in M. ulcerans (see Stinear et al., 2003). Similar to part of several e.g. Q9S0R8 Type I polyketide synthase AVES 1 from Streptomyces avermitilis (3972 aa), fasta scores: opt: 3342, E(): 2.1e-187, (40.556% identity in 2160 aa overlap); Q93NW8 AmphA from Streptomyces nodosus (1412 aa), fasta scores: opt: 3171, E(): 9.9e-178, (47.163% identity in 1304 aa overlap). Contains a Pfam match to entry PF00109 ketoacyl-synt: Beta-ketoacyl synthase, N-terminal domain and a Pfam match to entry PF02801 ketoacyl-synt_C: Beta-ketoacyl synthase, C-terminal domain. Contains a Pfam match entry PF00550 pp-binding: Phosphopantetheine attachment site and a Pfam match to entry PF00698 Acyl_transf: Acyl transferase domain.
Reference
ACC
PmId
[14736915] Giant plasmid-encoded polyketide synthases produce the macrolide toxin of Mycobacterium ulcerans. (Proc Natl Acad Sci U S A. , 2004)
[18493665] The unusual macrocycle forming thioesterase of mycolactone. (Mol Biosyst. , 2008)

close this sectionPKS/NRPS Module

A9 malonyl-CoA
KS35..408
AT590..912
DH955..1128
ER1470..1773
KR1783..1963
ACP2063..2133

close this sectionSequence

selected fasta
>polyketide synthase [Type I modular polyketide synthase]
MVSTEENLRVYLKQVITDLHQMQARLRKIEKQRSERVAVVGMACRFPGGVASADQLWDLV
IAGRDVVGNFPADRGWDVEGLFDPDPDAVGKTYTRYGAFLDDAAGFDAGFFGISPREARA
MDPQQRLLLEVCWEALETAGIPAHTLAGTSTGVFVGAWAQSYGATNSDGAEGYAMTGGST
SVMSGRIAYTLGLEGPAITVDTACSSSLVAIHLACQSLRNNESQLALAGGVTVMSTPAVF
TEFSRQRGLAPDGRCKAFAATADGTGWGEGAAVLVLERLSEARRNNHPVLAIVAGSAINQ
DGASNGLTAPHGPSQQRVINQALANAGLTHDQVDAVEAHGTGTTLGDPIEASALHATYGH
HHTPDQPLWLGSIKSNIGHTQAAAGAAGVVKMIQAITHATLPATLHVDQPSPHIDWSSGT
VRLLTEPIQWPNTDHPRTAAVSSFGISGTNAHLILQQPPTPDTTQTPNTTTGSDPAVGSD
SAVGSDPAVGVLVWPLSARSAPGLSAQAARLYQHLSAHPDLDPIDVAHSLATTRSHHPHR
ATITTSIEHHSENNHDTTDALAALHALANNGTHPLLSRGLLTPQGPGKTVFVFPGQGSQY
PGMGADLYRQFPVFAHALDEVAAALNPHLDVALLEVMFSQQDTAMAQLLDQTFYAQPALF
ALGTALHRLFTHAGIHPDYLLGHSIGELTAAYAAGVLSLQDAATLVTSRGRLMQSCTPGG
TMLALQASEAEVQPLLEGLDHAVSIAAINGATSIVLSGDHDSLEQIGEHFITQDRRTTRL
QVSHAFHSPHMDPILEQFRQIAAQLTFSAPTLPILSNLTGQIARHDQLASPDYWTQQLRN
TVRFHDTVAALLGAGEQVFLELSPHPVLTQAITDTVEQAGGGGAAVPALRKDRPDAVAFA
AALGQLHCHGISPSWNVLYCQARPLTLPTYAFQHQRYWLLPTAGDFSGANTHAMHPLLDT
ATELAENRGWVFTGRISPRTQPWLNEHAVESAVLFPGTGFVELALHVADRAGYSSVNELI
VHTPLLLAGHDTADLQITVTDTDDMGRQSLNIHSHPHIGHDNTTTGDEQPEWVLHASAVL
TAQTTDHNHLPLTPVPWPPPGTAAIEVDDFYDDLAAQGYNYGPTFQGVQRIWRDHATPDV
IYAEVELPEDTDIDGYGIHPALFDAALHPLLALTQPPTNDTDDTNTADTGDQVRLPYAFT
GISLHATHATRLRVRLTRTGADAITVHTSDTTGAPVAIIDSLITRPLTTATGSAPATTAA
GLLHLSWPPHPDTTTDTDTDTDALRYQVIAEPTQQLPRYLHDLHTSTDLHTSTTEADVVV
WPVPVPSNEELQAHQASDTAVSSRIHTLTRQTLTVVQDWLTHPDTTGTRLVIVTRHGVST
SAHDPVPDLAHAAVWGLIRSAQNEHPGRFTLLDTDDNTNSDTLTTALTLPTRENQLAIRR
DTIHIPRLTRTAVLTPPDSGPWRLDTTGKGDLANLALLPTAHTALASGQIRIDVRAAGLN
FHDVVVALGLIPDDGFGGEAAGVISEIGPDVYGFAVGDAVTGMTVSGAFAPSTVADHRMV
MTIPARWSFPQAASIPVVFLTAYIALAEISGLSRGQRVLIHAGTGGVGMAAIQLAHHLGA
EVFATASAAKWSTLEALGVPRDHIASSRTLDFSNAFLDATNGAGVDVVLNCLSGEFVEAS
LALLPRGGHFVEIGKTDIRDTEVIAATHPGVIYRALDLLSVSPDHIQRTLAQLSPLFATD
TLKPLPTTNYSIYQAISALRDMSQARHTGKIVLTAPVVVDPEGTVLITGGTGTLGALFAE
HLVSAHGVRHLLLTSRRGPQAHGATDLQQRLTDLGAHVTITACDISDPEALAALVNSVPT
QHRLTAVVHTAAVLADTPVTELTGDQLDQVLAPKIDAAWQLHQLTYEHNLSAFIMFSSMA
GMIGSPGQGNYAAANTALDALADYRHRLGLPATSLAWGYWQTRTGVTAHLTDVDLARMTR
LGLMPIATSHGLALFDAALATGQPVSIPAPINTHTLARHARDNTLTPILSALITTPRRRA
ASAATDLAARLNGLSPQQQQQTLATLVAAATATVLGHHTPESISPATAFKDLGIDSLTAL
ELRNTLTHNTGLDLPPTLIFDHPTPHALTQHLHTRLTQSHTPVGPIASLLSHAIDEGKFR
AGADLLMAASNLNQSFSNMAELNQLPAVTDIADASPDGLLTLICISTSENEYARLAAANI
HSLTFAEIAAPGFYDAQLPNSIETSAEALATAITGAYANTSIVLVAHSIVCELAQATMTR
LQDADIDLVGLVLLDPLEGTNSTEDYVETVLTRIEHINAPRVGVDGYLAALGRYLQFHED
RRIPIPETRHMTLHSDTKIDRAQTPMNLLQDEAALTALKIGNWMNDTGSIAVTLRDGPVF
LGRARSVNMR
selected fasta
>polyketide synthase [Type I modular polyketide synthase]
GTGGTGTCAACTGAAGAAAACCTACGCGTTTACTTAAAACAGGTCATCACAGACCTCCAC
CAAATGCAGGCACGTCTGCGGAAGATCGAAAAGCAGAGATCAGAGCGGGTGGCGGTGGTG
GGGATGGCGTGTCGTTTCCCCGGTGGTGTCGCATCAGCGGATCAGTTGTGGGACTTGGTG
ATCGCTGGCCGTGATGTGGTGGGTAATTTTCCGGCCGATCGGGGTTGGGATGTGGAGGGA
CTGTTTGATCCCGATCCGGACGCGGTCGGCAAAACCTACACCCGTTACGGCGCGTTCCTT
GACGATGCGGCAGGTTTTGATGCCGGGTTCTTTGGGATCTCTCCACGGGAGGCACGCGCG
ATGGACCCCCAGCAGCGGCTGCTGCTGGAGGTGTGCTGGGAAGCGCTAGAAACCGCGGGT
ATTCCCGCGCACACCTTGGCCGGCACCTCCACCGGGGTATTCGTCGGAGCCTGGGCCCAG
TCCTACGGCGCCACCAACTCCGATGGCGCTGAGGGGTATGCGATGACCGGCGGCTCGACT
AGCGTCATGTCCGGCCGTATCGCCTACACCTTGGGCCTAGAAGGTCCAGCGATCACCGTT
GACACCGCCTGCTCGTCATCGCTGGTGGCAATTCACCTGGCCTGCCAATCCTTACGCAAC
AACGAATCCCAGCTAGCACTGGCCGGCGGCGTCACCGTGATGAGCACACCTGCGGTTTTC
ACCGAGTTCTCCCGCCAACGCGGCCTGGCCCCAGATGGACGCTGCAAAGCCTTCGCCGCT
ACCGCCGATGGCACCGGCTGGGGTGAAGGCGCCGCGGTCTTGGTCCTTGAACGGCTCTCC
GAGGCCCGCCGCAACAACCACCCGGTCCTTGCGATCGTCGCTGGATCGGCGATCAACCAA
GACGGCGCATCCAACGGACTGACCGCACCCCACGGCCCGTCACAACAACGCGTCATCAAC
CAAGCACTAGCCAACGCCGGCCTCACCCACGACCAGGTCGACGCCGTCGAAGCCCACGGC
ACCGGCACCACACTGGGTGACCCCATCGAAGCCAGCGCCCTACACGCCACCTACGGCCAC
CACCACACGCCCGATCAACCGCTTTGGCTGGGATCCATCAAATCCAACATCGGCCACACC
CAAGCCGCCGCCGGCGCCGCCGGTGTGGTCAAGATGATCCAAGCCATCACCCACGCCACC
TTGCCCGCCACCTTGCACGTCGACCAACCCAGCCCCCACATCGACTGGTCCAGCGGCACA
GTCCGACTCCTAACCGAGCCCATCCAATGGCCCAACACCGACCACCCCCGCACCGCGGCG
GTGTCCTCATTCGGCATCAGCGGCACCAACGCCCACCTCATCCTCCAACAACCCCCCACC
CCCGACACCACACAAACCCCCAACACCACAACAGGTTCTGATCCCGCAGTGGGTTCTGAT
TCCGCAGTGGGTTCTGATCCCGCAGTGGGTGTACTGGTGTGGCCGTTGTCAGCGCGTTCA
GCGCCGGGGTTAAGCGCACAAGCGGCCCGTCTGTACCAGCATCTCAGCGCCCACCCCGAT
CTGGATCCGATCGATGTAGCCCACAGCCTGGCTACCACACGCAGCCACCACCCCCACCGC
GCCACCATCACCACCAGCATTGAGCACCACAGCGAAAACAACCACGACACAACCGATGCG
CTGGCCGCACTGCACGCCCTGGCCAACAACGGCACACACCCCCTGCTGAGCAGAGGCCTG
CTGACCCCACAGGGCCCCGGCAAAACAGTGTTCGTGTTCCCCGGACAGGGCAGTCAATAC
CCCGGCATGGGCGCAGATCTCTACCGCCAATTCCCCGTGTTCGCCCACGCCCTCGACGAG
GTCGCTGCGGCGCTGAACCCGCATCTCGATGTTGCGTTGCTTGAGGTGATGTTCAGCCAA
CAAGACACTGCCATGGCGCAACTGCTGGACCAGACCTTCTATGCACAACCGGCGTTGTTC
GCGCTGGGAACCGCTCTACATCGATTGTTCACCCACGCCGGTATCCACCCGGACTACCTG
CTAGGCCACTCCATCGGAGAACTCACCGCGGCATACGCCGCCGGTGTGCTGTCACTGCAA
GACGCAGCCACCTTGGTCACAAGCCGAGGACGACTGATGCAATCCTGCACGCCCGGCGGG
ACGATGCTCGCACTACAAGCCAGCGAAGCAGAAGTACAACCGCTGCTTGAAGGCCTAGAC
CACGCCGTGTCCATCGCCGCGATCAACGGAGCAACGTCGATCGTACTGTCAGGAGATCAC
GACAGCCTCGAACAAATCGGCGAGCACTTCATTACCCAAGATCGACGTACCACCCGACTG
CAGGTCAGTCACGCTTTCCACTCTCCACATATGGACCCCATCCTCGAACAATTCCGCCAG
ATCGCGGCCCAACTCACCTTCAGCGCACCCACCCTGCCCATCTTGTCCAACCTCACCGGG
CAGATCGCCCGCCACGACCAACTCGCCTCACCTGACTATTGGACCCAACAGCTACGTAAC
ACTGTCCGGTTCCATGACACTGTCGCTGCCCTGCTCGGGGCGGGTGAGCAGGTTTTCCTG
GAACTTTCACCTCACCCGGTGTTGACACAAGCGATCACCGACACCGTCGAACAAGCCGGC
GGCGGCGGCGCAGCAGTGCCAGCTCTACGCAAGGATCGCCCTGATGCTGTCGCGTTCGCT
GCAGCACTCGGCCAGCTGCACTGCCATGGCATCAGCCCATCCTGGAATGTTCTTTACTGC
CAGGCCCGCCCCCTCACACTGCCCACCTACGCTTTCCAGCATCAGCGTTACTGGCTGCTG
CCCACCGCTGGTGATTTCAGCGGGGCCAATACCCACGCCATGCATCCGCTGCTAGACACC
GCCACCGAACTGGCCGAAAACCGCGGATGGGTGTTCACCGGCCGGATCAGCCCACGCACC
CAACCATGGCTAAACGAACACGCCGTCGAATCAGCCGTGCTGTTCCCAGGCACCGGATTT
GTCGAGCTAGCGCTGCATGTCGCTGACCGTGCCGGATATTCCTCGGTCAACGAACTGATC
GTGCACACCCCCCTGCTACTCGCTGGCCACGACACCGCGGATCTACAGATCACCGTCACC
GACACCGATGACATGGGCCGGCAGTCTCTTAACATCCACTCGCACCCACATATCGGCCAT
GACAACACCACCACCGGCGATGAACAACCCGAGTGGGTCCTGCATGCCAGCGCAGTCCTG
ACCGCACAAACCACCGACCACAACCACCTCCCCCTAACGCCTGTGCCGTGGCCTCCACCC
GGCACAGCCGCGATCGAGGTGGATGACTTCTACGACGACCTGGCTGCACAGGGCTACAAC
TACGGCCCGACATTCCAAGGTGTGCAACGGATATGGCGTGACCACGCCACACCCGATGTC
ATCTACGCCGAAGTTGAACTACCCGAAGACACCGACATCGACGGCTACGGCATCCACCCC
GCCCTATTCGACGCCGCTTTACACCCCCTACTCGCCCTGACCCAACCCCCCACCAACGAC
ACCGATGACACCAACACCGCAGACACCGGTGACCAGGTGCGGCTGCCCTACGCCTTTACC
GGCATCAGTTTGCACGCCACCCACGCCACCCGATTGCGGGTACGGCTGACCCGTACCGGC
GCCGATGCCATCACCGTGCACACCAGTGACACCACCGGAGCCCCGGTGGCGATCATCGAC
TCATTGATCACCCGCCCCCTCACCACCGCCACAGGGTCTGCTCCGGCAACCACAGCAGCT
GGCCTACTACACCTGAGCTGGCCACCACACCCTGACACCACGACCGACACCGACACCGAC
ACCGATGCCCTGCGGTATCAGGTGATCGCCGAACCCACTCAACAACTGCCCCGCTACCTG
CACGACCTACACACCAGCACCGACCTGCACACCAGCACCACCGAAGCAGACGTGGTTGTG
TGGCCGGTACCGGTGCCCAGCAACGAAGAGCTCCAGGCACACCAAGCATCCGACACCGCG
GTGTCTTCTCGGATACACACCCTGACCCGCCAAACACTTACCGTGGTGCAGGACTGGCTC
ACTCACCCCGACACCACCGGCACCCGACTGGTCATCGTGACCCGCCACGGCGTCAGCACC
AGTGCCCACGACCCGGTCCCCGACCTAGCCCACGCCGCAGTGTGGGGCCTGATCCGCAGC
GCCCAAAACGAACACCCCGGACGCTTCACACTGCTCGACACCGACGACAACACCAACAGC
GACACCCTCACCACCGCCCTAACCCTGCCAACCCGCGAAAACCAACTGGCCATACGCCGC
GACACCATCCACATCCCCCGCCTGACCCGCACCGCTGTCCTGACACCACCGGACAGCGGC
CCCTGGCGCCTTGACACCACCGGCAAGGGTGATCTGGCCAACCTCGCCCTGCTACCGACC
GCCCACACTGCCCTGGCCTCTGGACAAATCCGTATCGATGTCCGGGCCGCTGGTTTGAAT
TTTCACGACGTGGTCGTCGCGTTGGGGCTAATCCCCGACGACGGATTCGGCGGAGAAGCC
GCCGGGGTGATCAGCGAGATCGGTCCCGACGTCTACGGATTCGCCGTGGGTGATGCCGTG
ACCGGCATGACCGTCTCTGGTGCGTTTGCCCCCAGCACTGTCGCTGATCACCGCATGGTG
ATGACGATCCCGGCCCGGTGGTCCTTCCCCCAAGCCGCATCCATACCGGTGGTATTCCTG
ACCGCCTACATCGCTTTGGCCGAGATCTCGGGCCTAAGCCGAGGGCAACGAGTGCTGATC
CATGCCGGCACTGGCGGTGTGGGTATGGCTGCGATTCAATTGGCACACCATTTGGGTGCC
GAAGTATTCGCCACCGCCAGCGCCGCGAAATGGAGCACCCTTGAGGCACTGGGGGTACCG
CGCGACCATATCGCTTCCTCGCGTACTCTGGACTTTTCCAACGCATTCCTCGATGCCACC
AACGGCGCCGGTGTTGATGTCGTATTGAACTGCCTCAGTGGTGAATTCGTCGAAGCATCC
CTAGCCCTGCTGCCCCGCGGTGGCCATTTCGTCGAAATCGGCAAAACCGACATCCGTGAT
ACCGAGGTCATCGCCGCAACCCATCCCGGCGTCATTTACCGCGCCCTCGATCTGCTCAGC
GTCTCCCCCGATCACATCCAGCGCACACTGGCCCAACTGTCCCCACTGTTTGCCACCGAC
ACCCTAAAACCCCTACCGACCACTAATTACAGCATCTACCAAGCCATCTCGGCCTTACGT
GACATGAGTCAAGCCCGTCACACAGGCAAGATCGTGCTCACTGCGCCGGTGGTGGTAGAT
CCTGAGGGCACGGTGTTGATCACCGGGGGGACCGGGACGCTGGGTGCCTTGTTCGCCGAG
CATCTGGTTTCTGCCCATGGTGTCCGGCATCTGTTGTTGACCTCGCGGCGCGGACCTCAG
GCCCACGGTGCCACCGATCTGCAGCAGCGGCTCACCGATCTAGGTGCTCATGTCACCATC
ACGGCCTGCGATATCAGCGACCCCGAAGCACTGGCCGCCCTGGTCAATTCAGTGCCCACA
CAACACCGTTTAACCGCGGTAGTGCACACCGCCGCGGTATTGGCCGACACCCCGGTCACC
GAGTTGACCGGCGATCAACTCGACCAGGTGCTGGCCCCCAAAATCGACGCGGCATGGCAG
CTGCACCAACTCACCTACGAACACAACCTGTCTGCATTCATCATGTTCTCGTCCATGGCC
GGAATGATAGGCAGTCCCGGTCAGGGTAACTACGCGGCAGCCAACACCGCGTTAGATGCT
CTCGCCGACTACCGCCACCGCCTGGGCTTGCCCGCGACCAGCCTGGCCTGGGGCTACTGG
CAGACCCGCACCGGTGTCACCGCGCATCTAACCGATGTAGATCTAGCCCGCATGACCCGC
CTGGGTTTGATGCCCATCGCCACCAGCCACGGACTGGCCCTGTTCGATGCCGCCCTCGCC
ACCGGACAGCCCGTTTCGATACCCGCCCCGATCAACACCCACACCCTGGCCCGACACGCC
CGCGACAACACCCTGACCCCGATCCTGTCTGCGCTGATCACCACACCACGGCGCCGGGCG
GCCTCTGCCGCAACCGATCTCGCTGCCCGCCTCAACGGACTTAGCCCCCAACAGCAACAA
CAAACACTGGCCACCCTCGTGGCCGCGGCCACCGCCACCGTGCTGGGCCACCACACCCCC
GAAAGCATCAGCCCAGCCACCGCGTTCAAAGACCTCGGAATCGATTCGCTGACCGCCCTT
GAACTGCGCAACACCCTCACCCACAACACCGGCCTGGATCTGCCCCCCACCCTCATCTTC
GATCACCCCACACCCCATGCGCTAACCCAACACCTGCACACCCGACTCACCCAAAGCCAT
ACCCCGGTCGGACCAATTGCGTCCCTGCTAAGCCACGCGATCGATGAGGGCAAATTCCGT
GCCGGCGCTGACCTATTGATGGCCGCATCCAATTTGAACCAAAGTTTCAGCAATATGGCT
GAACTCAACCAGCTCCCGGCCGTGACGGACATAGCTGACGCGTCTCCTGATGGGCTACTC
ACCCTGATCTGCATCTCTACCTCAGAGAATGAGTACGCTCGCCTCGCTGCTGCGAACATT
CATTCACTGACCTTCGCTGAAATTGCGGCGCCCGGCTTTTACGACGCGCAGCTGCCAAAT
TCGATAGAGACGTCGGCAGAGGCGCTGGCAACTGCCATCACAGGCGCCTACGCAAATACG
TCCATTGTTCTGGTAGCGCACTCCATTGTCTGCGAGCTAGCTCAGGCAACGATGACACGT
CTACAAGACGCTGACATCGATCTTGTGGGTCTGGTTCTGTTGGATCCACTCGAAGGGACT
AACAGCACTGAAGATTATGTGGAGACAGTCTTGACTCGAATCGAGCATATCAATGCACCG
AGGGTCGGAGTAGACGGTTACCTTGCCGCCCTGGGCCGCTATCTCCAATTCCACGAAGAC
CGCCGAATACCAATACCGGAAACGCGGCACATGACACTGCACTCGGACACGAAAATTGAC
CGTGCCCAAACACCAATGAACTTATTACAAGATGAGGCAGCGTTGACCGCCCTCAAAATA
GGAAACTGGATGAACGACACAGGGAGTATCGCAGTAACACTGAGAGATGGACCCGTATTC
TTGGGCAGGGCCCGCTCTGTCAACATGAGGTGA
[9] KS35..408
[9] AT590..912
[9] malonyl-CoA784..788
[9] DH955..1128
[9] ER1470..1773
[9] KR1783..1963
[9] ACP2063..2133
[9] KS103..1224
[9] AT1768..2736
[9] malonyl-CoA2350..2364
[9] DH2863..3384
[9] ER4408..5319
[9] KR5347..5889
[9] ACP6187..6399

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [584-716]  2.30000000000004e-79 G3DSA:3.40.366.10 [784-900]  2.30000000000004e-79 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [2091-2106]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [2067-2132]  8.60000000000001e-13 PF00550
PF00550   PP-binding
 [2063-2133]  PS50075
PS50075   ACP_DOMAIN
 [2056-2153]  9.19998414420358e-21 SSF47336
SSF47336   ACP_like
 [2060-2137]  1.3e-21 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR011032 GroES-like (Domain)
 [1461-1602]  5.29999657550189e-28 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [1606-1713]  2.2e-19 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [1488-1543]  4.1e-05 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1783-1961]  7.20000000000003e-62 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [35-282]  3.70000000000004e-97 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [290-408]  1.99999999999999e-44 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [590-912]  2.79999999999994e-73 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [3-35]  6.40000038788486e-07 SSF101173
SSF101173   Polyketide_synth_docking
 [3-27]  2e-08 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [588-880]  1.90000694315261e-71 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [718-783]  2.49999811956465e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [37-294]  5.69999999999998e-93 G3DSA:3.40.47.10 [295-460]  1.2e-62 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [27-406]  8.79996401030984e-100 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1558-1747]  1.40000000000001e-52 G3DSA:3.40.50.720 [1783-1964]  1.29999999999998e-39 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [195-211]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [592-893]  6.19996040581186e-121 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [2064-2136]  2.39999798157265e-32 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [955-1128]  3.39999972437719e-71 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [37-460]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1783-1963]  3.49999466863949e-57 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [1470-1773]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit