close all open/close all

CDS information : MUP_00400


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction137,271 / 86,299 / - [in whole cluster]
137,271 / 86,299 / - [in contig]
Locationcomplement(86299..137271) [in whole cluster]
complement(86299..137271) [in contig]
TypeCDS
Length50,973 bp (16,990 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)Type I modular polyketide synthase
Gene
Gene (GenBank)mlsA1
EC number
Keyword
Note
Note (GenBank)
  • MUP040c, mlsA1, len: 16990 aa. Type I modular polyketide synthase, composed of a loading module and eight extender modules; required for the synthesis of the mycolactone core in M. ulcerans (see Stinear et al., 2003). Similar to the modules in several other bacterial polyketide synthases e.g. O33954 Tylactone synthase starter module and modules 1 & 2 from Streptomyces fradiae (4472 aa), fasta scores: opt: 5121, E(): 0, (41.958% identity in 4066 aa overlap); Q9ALM3 Polyketide synthase extender modules 5-7 from Saccharopolyspora spinosa (4928 aa), fasta scores: opt: 4860, E(): 0, (41.813% identity in 5515 aa overlap); and Q9ADL6 Soraphen polyketide synthase A from Polyangium cellulosum (6315 aa), fasta scores: opt: 4448, E(): 0, (39.533% identity in 6420 aa overlap). Contains 9 x Pfam matches to entry PF00109 ketoacyl-synt: Beta-ketoacyl synthase, N-terminal domain and 9 x Pfam match to entry PF02801 ketoacyl-synt_C: Beta-ketoacyl synthase, C-terminal domain. Contains 9 x Pfam match entry PF00550 pp-binding: Phosphopantetheine attachment site and 9 x Pfam match to entry PF00698 Acyl_transf: Acyl transferase domain.
Reference
ACC
PmId
[14736915] Giant plasmid-encoded polyketide synthases produce the macrolide toxin of Mycobacterium ulcerans. (Proc Natl Acad Sci U S A. , 2004)

close this sectionPKS/NRPS Module

A0 malonyl-CoA
1 malonyl-CoA
2 methylmalonyl-CoA
not conserved YASHS(A->P)
3 methylmalonyl-CoA
not conserved YASHS(A->P)
4 methylmalonyl-CoA
not conserved YASHS(A->P)
5 malonyl-CoA
6 methylmalonyl-CoA
not conserved YASHS(A->P)
7 methylmalonyl-CoA
not conserved YASHS(A->P)
8 malonyl-CoA
KSQ19..390
AT567..889
dh932..1105
KR1444..1624
ACP1724..1794
KS1817..2190
AT2372..2694
dh2737..2910
KR3249..3429
ACP3529..3599
KS3622..3995
AT4177..4499
dh4542..4715
er5057..5360
KR5370..5550
ACP5650..5720
KS5743..6116
AT6298..6620
DH6663..6836
KR7175..7355
ACP7455..7525
KS7547..7920
AT8096..8418
DH8461..8634
ER8976..9279
KR9289..9469
ACP9569..9639
KS9662..10035
AT10204..10517
KR10830..11006
ACP11108..11178
KS11201..11574
AT11750..12072
DH12115..12288
KR12621..12801
ACP12901..12971
KS12994..13367
AT13543..13865
DH13908..14081
ER14423..14726
KR14736..14916
ACP15016..15086
KS15108..15481
AT15663..15985
dh16028..16201
KR16542..16722
ACP16822..16892

close this sectionSequence

selected fasta
>polyketide synthase [Type I modular polyketide synthase]
MIFGDAHQNCRGGRVLGDAVAVVGMSCRVPGASDPDALWALLRDGISVVDEIPSARWNLD
GLVAHRLTDEQRSALRHGAFLDDVEGFDAAFFGINPSEAGSMDPQQRLMLELTWAALEDA
RIVPEHLSGSSSGVFTGAMSDDYTTAVTYRAAMTAHTFAGTHRSLIANRVSYTLGLRGPS
LVIDTGQSSSLVAVHVAMESLRREETSLAIAGGIHLNLSLAAALSAAHFGALSPDGRCYT
FDARANGYVRGEGGGVVVLKRLNDALADGNHIYCVIRGSSVNNDGATQDLTAPGVDGQRQ
ALLQAYERAEIDPSEVQYVELHGTGTRLGDPTEAHSLHSVFGTSTVPRSPLLVGSIKTNI
GHLEGAAGILGLIKTALAVHHRQLPPSLNYTVPNPKIPLEQLGLRVQTTLSEWPDLDKPL
TAGVSSFSMGGTNAHLILQQPPTPDTTQTPNPTTGSDPAVGSDPAVGVLVWPLSARSAPG
LSAQAARLYQHLSAHPDLDPIDVAHSLATTRSHHPHRATITTSIEHHSENNHDTTDALAA
LHALANNGTHPLLSRGLLTPQGPGKTVFVFPGQGSQYPGMGADLYRQFPVFAHALDEVAA
ALNPHLDVALLEVMFSQQDTAMAQLLDQTFYAQPALFALGTALHRLFTHAGIHPDYLLGH
SIGELTAAYAAGVLSLQDAATLVTSRGRLMQSCTPGGTMLALQASEAEVQPLLEGLDHAV
SIAAINGATSIVLSGDHDSLEQIGEHFITQDRRTTRLQVSHAFHSPHMDPILEQFRQIAA
QLTFSAPTLPILSNLTGQIARHDQLASPDYWTQQLRNTVRFHDTVAALLGAGEQVFLELS
PHPVLTQAITDTVEQAGGGGAAVPALRKDRPDAVAFAAALGQLHCHGISPSWNVLYCQAR
PLTLPTYAFQHQRYWLLPTAGDFSGANTHAMHPLLDTATELAENRGWVFTGRISPRTQPW
LNEHAVESAVLFPNTGFVELALHVADRAGYSSVNELIVHTPLLLAGHDTADLQITVTDTD
DMGRQSLNIHSHPHIGHDNTTTGDEQPEWVLHASAVLTAQTTDHNHLPLTPVPWPPPGTA
AIEVDDFYDDLAAQGYNYGPTFQGVQRIWRDHATPDVIYAEVELPEDTDIDGYGIHPALF
DAALHPLLALTQPPTNDTDDTNTADTGDQVRLPYAFTGISLHATHATRLRVRLTRTGADA
ITVHTSDTTGAPVAIIDSLITRPLTTATGSAPATTAAGLLHLSWPPHPDTTTDTDTDTDA
LRYQVIAEPTQQLPRYLHDLHTSTDLHTSTTEADVVVWPVPVPSNEELQAHQASDTAVSS
RIHTLTRQTLTVVQDWLTHPDTTGTRLVIVTRHGVSTSAHDPVPDLAHAAVWGLIRSAQN
EHPGRFTLLDTDDNTNSDTLTTALTLPTRENQLAIRRDTIHIPRLTRHSSDGALTAPVVV
DPEGTVLITGGTGTLGALFAEHLVSAHGVRHLLLTSRRGPQAHGATDLQQRLTDLGAHVT
ITACDISDPEALAALVNSVPTQHRLTAVVHTAAVLADTPVTELTGDQLDQVLAPKIDAAW
QLHQLTYEHNLSAFIMFSSMAGMIGSPGQGNYAAANTALDALADYRHRLGLPATSLAWGY
WQTHTGLTAHLTDVDLARMTRLGLMPIATSHGLALFDAALATGQPVSIPAPINTHTLARH
ARDNTLAPILSALITTPRRRAASAATDLAARLNGLSPQQQQQTLATLVAAATATVLGHHT
PESISPATAFKDLGIDSLTALELRNTLTHNTGLNLSSTLIFDHPTPHAVAEHLLEQIPGI
GALVPAPVVIAAGRTEEPVAVVGMACRFPGGVASADQLWDLVIAGRDVVGNFPADRGWDV
EGLFDPDPDAVGKTYTRYGAFLDDAAGFDAGFFGISPREARAMDPQQRLLLEVCWEALET
AGIPAHTLAGTSTGVFVGAWAQSYGATNSDDAEGYAMTGGATSVMSGRIAYTLGLEGPAI
TVDTACSSSLVAIHLACQSLRNNESQLALAGGVTVMSTPAVFTDFSRQRGLAPDGRCKAF
AATADGTGWGEGAAVLVLERLSEARRNNHPVLAIVAGSAINQDGASNGLTAPHGPSQQRV
INQALANAGLTHDQVDAVEAHGTGTTLGDPIEAGALHATYGHHHTPDQPLWLGSIKSNIG
HTQAAAGAAGVVKMIQAITHATLPATLHVDQPSPHIDWSSGTVRLLTEPIQWPNTDHPRT
AAVSSFGISGTNAHLILQQPPTPDTTQTPNPTTGSDPAVGSDSAVGSDPAVGVLVWPLSA
RSAPGLSAQAARLYQHLSAHPDLDPIDVAHSLATTRSHHPHRATITTSIEHHSENNHDTT
DALAALHALANNGTHPLLSRGLLTPQGPGKTVFVFPGQGSQYPGMGADLYRQFPVFAHAL
DEVAAALNPHLDVALLEVMFSQQDTAMAQLLDQTFYAQPALFALGTALHRLFTHAGIHPD
YLLGHSIGELTAAYAAGVLSLQDAATLVTSRGRLMQSCTPGGTMLALQASEAEVQPLLEG
LDHAVSIAAINGATSIVLSGDHDSLEQIGEHFITQDRRTTRLQVSHAFHSPHMDPILEQF
RQIAAQLTFSAPTLPILSNLTGQIARHDQLASPDYWTQQLRNTVRFHDTVAALLGAGEQV
FLELSPHPVLTQAITDTVEQAGGGGAAVPALRKDRPDAVAFAAALGQLHCHGISPSWNVL
YCQARPLTLPTYAFQHQRYWLLPTAGDFSGANTHAMHPLLDTATELAENRGWVFTGRISP
RTQPWLNEHAVESAVLFPNTGFVELALHVADRAGYSSVNELIVHTPLLLAGHDTADLQIT
VTDTDDMGRQSLNIHSRPHIGHDNTTTGDEQPEWVLHASAVLTAQTTDHNHLPLTPVPWP
PPGTAAIEVDDFYDDLAAQGYNYGPTFQGVQRIWRDHATPDVIYAEVELPEDTDIDGYGI
HPALFDAALHPLLALTQPPTNDTDDTNTADTGDQVRLPYAFTGISLHATHATRLRVRLTR
TGADAITVHTSDTTGAPVAIIDSLITRPLTTATGSAPATTAAGLLHLSWPPHPDTTTDTD
TDTDALRYQVIAEPTQQLPRYLHDLHTSTDLHTSTTEADVVVWPVPVPSNEELQAHQASD
TAVSSRIHTLTRQTLTVVQDWLTHPDTTGTRLVIVTRHGVSTSAHDPVPDLAHAAVWGLI
RSAQNEHPGRFTLLDTDDNTNSDTLTTALTLPTRENQLAIRRDTIHIPRLTRHSSDGALT
APVVVDPEGTVLITGGTGTLGALFAEHLVSAHGVRHLLLTSRRGPQAHGATDLQQRLTDL
GAHVTITACDISDPEALAALVNSVPTQHRLTAVVHTAAVLADTPVTELTGDQLDQVLAPK
IDAAWQLHQLTYEHNLSAFIMFSSMAGMIGSPGQGNYAAANTALDALADYRHRLGLPATS
LAWGYWQTHTGLTAHLTDVDLARMTRLGLMPIATSHGLALFDAALATGQPVSIPAPINTH
TLARHARDNTLAPILSALITTPRRRAASAATDLAARLNGLSPQQQQQTLATLVAAATATV
LGHHTPESISPATAFKDLGIDSLTALELRNTLTHNTGLNLSSTLIFDHPTPHAVAEHLLE
QIPGIGALVPAPVVIAAGRTEEPVAVVGMACRFPGGVASADQLWDLVIAGRDVVGNFPAD
RGWDVEGLFDPDPDAVGKTYTRYGAFLDDAAGFDAGFFGISPREARAMDPQQRLLLEVCW
EALETAGIPAHTLAGTSTGVFVGAGAQSYGATNSDDAEGYAMTGGATSVMSGRIAYTLGL
EGPAITVDTACSSSLVAIHLACQSLRNNESQLALAGGVTVMSTPAIFTEFSRQRGLAPDG
RCKAFAATADGTGWGEGAAVLVLERLSEARRNNHPVLAIVAGSAINQDGASNGLTAPHGP
SQQRVINQALANAGLTHDQVDAVEAHGTGTTLGDPIEAGALHATYGHHHTPDQPLWLGSI
KSNIGHTQAAAGAAGVVKMIQAITHATLPATLHVDQPSPHIDWSSGTVRLLTEPIQWPNT
DHPRTAAVSSFGISGTNAHLILQQPPTPDTTQTPNPTTGSDPAVGSDSAVGSDPAVGVLV
WPLSARSAPGLSAQAARLYQHLSAHPDLDPIDVAHSLATTRSHHPHRATITTSIEHHSEN
NHDTTDALAALHALANNGTHPLLSRGLLTPQGPGKTVFVFPGQGSQYPGMGADLYRQFPV
FAHALDACDAALQPFTGWSVLAVLHDEPEAPSLERVDVVQPVLFSVMVSLAALWRWAGIT
PDAVIGHSQGEIAAAHVAGALTLPEAAAVVALRSRVLTDLAGAGAMASVLSPEEPLTQLL
ARWDGKITVAAVNGPASAVVSGDTTAITELLITCEHENIDARAIPVDYPSHSPYMEHIRH
QFLDELPELTPRPSTIAMYSTVDGEPHDTAYDTTTMTADYWYRNIRNTVRFHDTVAALLG
AGEQVFLELSPHPVLTQAITDTVEQAGGGGAAVPALRKDRPDAVAFAAALGQLHCHGISP
SWNVLYCQARPLTLPTYAFQHQRYWLLPTAGDFSGANTHAMHPLLDTATELAENRGWVFT
GRISPRTQPWLNEHAVESAVLFPGTGFVELALHVADRAGYSSVNELIVHTPLLLAGHDTA
DLQITVTDTDDMGRQSLNIHSRPHIGHDNTTTGDEQPEWVLHASAVLTAQTTDHNHLPLT
PVPWPPPGTAAIEVDDFYDDLAAQGYNYGPTFQGVQRIWRDHATPDVIYAEVELPEDTDI
DGYGIHPALFDAALHPLLALTQPPTNDTDDTNTADTGDQVRLPYAFTGISLHATHATRLR
VRLTRTGADAITVHTSDTTGAPVAIIDSLITRPLTTATGSAPATTAAGLLHLSWPPHPDT
TTDTDTDTDALRYQVIAEPTQQLPRYLHDLHTSTDLHTSTTEADVVVWPVPVPSNEELQA
HQASDTAVSSRIHTLTRQTLTVVQDWLTHPDTTGTRLVIVTRHGVSTSAHDPVPDLAHAA
VWGLIRSAQNEHPGRFTLLDTDDNTNSDTLTTALTLPTRENQLAIRRDTIHIPRLTRTAV
LTPPDSGPWRLDTTGKGDLANLALLPTAHTALASGQIRIDVRAAGLNFHDVVVALGLIPD
DGFGGEAAGVISEIGPDVYGFAVGDAVTGMTVSGAFAPSTVADHRMVMTIPARWSFPQAA
SIPVVFLTAYIALAEISGLSRGQRVLIHAGTGGVGMAAIQLAHHLGAEVFATASAAKWST
LEALGVPRDHIASSRTLDFSNAFLDATNGAGVDVVLNCLSGEFVEASLALLPRGGHFVEI
GKTDIRDTEVIAATHPGVIYRALDLLSVSPDHIQRTLAQLSPLFATDTLKPLPTTNYSIY
QAISALRDMSQARHTGKIVLTAPVVVDPEGTVLITGGTGTLGALFAEHLVSAHGVRHLLL
TSRRGPQAHGATDLQQRLTDLGAHVTITACDISDPEALAALVNSVPTQHRLTAVVHTAVV
LADTPVTELTGDQLDQVLAPKIDAAWQLHQLTYEHNLSAFIMFSSMAGMIGSPGLGNYAA
ANTALDALADYRHRLGLPATSLAWGYWQTRTGLTAHLTDVDLARMTRLGLMPIATSHGLA
LFDAALATGQPVSIPAPINTHTLARHARDNTLAPILSALITTPRRRAASAATDLAARLNG
LSPQQQQQTLATLVAAATATVLGHHTPESISPATAFKDLGIDSLTALELRNTLTHNTGLN
LSSTLIFDHPTPHAVAEHLLEQIPGIGALVPAPVVIAAGRTEEPVAVVGMACRFPGGVAS
ADQLWDLVIAGRDVVGNFPADRGWDVEGLFDPDPDAVGKTYTRYGAFLDDAAGFDAGFFG
ISPREARAMDPQQRLLLEVCWEALETAGIPAHTLAGTSTGVFVGAGAQSYGATNSDGAEG
YAMTGGAISVMSGRIAYTLGLEGPAITVDTACSSSLVAIHLACQSLRNNESQLALAGGVT
VMSTPAIFTEFSRQRGLAPDGRCKAFAATADGTGFGEGAAVLVLERLSEARRNNHPVLAI
VAGSAINQDGASNGLTAPHGPSQQRVINQALANAGLTHDQVDAVEAHGTGTTLGDPIEAS
ALHATYGHHHTPDQPLWLGSIKSNIGHTQAAAGAAGVVKMIQAITHATLPATLHVDQPSP
HIDWSSGTVRLLTEPIQWPNTDHPRTAAVSSFGISGTNAHLILQQPPTPDTTQTPNTTTG
SDPAVGSDSAVGSDPAVGVLVWPLSARSAPGLSAQAARLYQHLSAHPDLDPIDVAHSLAT
TRSHHPHRATITTSIEHHSENNHDTTDALAALHALANNGTHPLLSRGLLTPQGPGKTVFV
FPGQGSQYPGMGADLYRQFPVFAHALDACDAALQPFTGWSVLAVLHDEPEAPSLERVDVV
QPVLFSVMVSLAALWRWAGITPDAVIGHSQGEIAAAHVAGALTLPEAAAVVALRSRVLTD
LAGAGAMASVLSPEEPLTQLLARWDGKITVAAVNGPASAVVSGDTTAITELLITCEHENI
DARAIPVDYPSHSPYMEHIRHQFLDELPELTPRPSTIAMYSTVDGEPHDTAYDTTTMTAD
YWYRNIRNTVRFHDTVAALLGAGEQVFLELSPHPVLTQAITDTVEQAGGGGAAVPALRKD
RPDAVAFAAALGQLHCHGISPSWNVLYCQARPLTLPTYAFQHQRYWLLPTAGDFSGANTH
AMHPLLDTATELAENRGWVFTGRISPRTQPWLNEHAVESAVLFPGTGFVELALHVADRAG
YSSVNELIVHTPLLLAGHDTADLQITVTDTDDMGRQSLNIHSRPHIGHDNTTTGDEQPEW
VLHASAVLTAQTTDHNHLPLTPVPWPPPGTAAIEVDDFYDDLAAQGYNYGPTFQGVQRIW
RDHATPDVIYAEVELPEDTDIDGYGIHPALFDAALHPLLALTQPPTNDTDDTNTADTGDQ
VRLPYAFTGISLHATHATRLRVRLTRTGADAITVHTSDTTGAPVAIIDSLITRPLTTATG
SAPATTAAGLLHLSWPPHPDTTTDTDTDTDALRYRVIAEPTQQLPRYLHDLHTSTDLHTS
TTEADVVVWPVPVPSNEELQAHQASDTAVSSRIHTLTRQTLTVVQDWLTHPDTTGTRLVI
VTRHGVSTSAHDPVPDLAHAAVWGLIRSAQNEHPGRFTLLDTDDNTNSDTLTTALTLPTR
ENQLAIRRDTIHIPRLTRHSSDGALTAPVVVDPEGTVLITGGTGTLGALFAEHLVSAHGV
RHLLLTSRRGPQAHGATDLQQRLTDLGAHVTITACDISDPEALAALVNSVPTQHRLTAVV
HTAAVLADTPVTELTGDQLDQVLAPKIDAAWQLHQLTYEHNLSAFIMFSSMAGMIGSPGQ
GNYAAANTALDALADYRHRLGLPATSLAWGYWQTHTGLTAHLTDVDLARMTRLGLMPIAT
SHGLALFDAALATGQPVSIPAPINTHTLARHARDNTLAPILSALITTPRRRAASAATDLA
ARLNGLSPQQQQQTLATLVAAATATVLGHHTPESISPATAFKDLGIDSLTALELRNTLTH
NTGLDLPPTLIFDHPTPTALTQHLHTRLTTGALVPAPVVIAAGRTEEPVAVVGMACRFPG
GVASADQLWDLVIAGRDVVGNFPADRGWDVEGLFDPDPDAVGKTYTRYGAFLDDAAGFDA
GFFGISPREARAMDPQQRLLLEVCWEALETAGIPAHTLAGTSTGVFVGAWAQSYGATNSD
DAEGYAMTGGAISVMSGRIAYTLGLEGPAITVDTACSSSLVAIHLACQSLRNNESQLALA
GGVTVMSTPAVFTDFSRQRGLAPDGRCKAFAATADGTGFGEGAAVLVLERLSEARRNNHP
VLAIVAGSAINQDGASNGLTAPHGPSQQRVINQALANAGLTHDQVDAVEAHGTGTTLGDP
IEAGALHATYGHHHTPDQPLWLGSIKSNIGHTQAAAGAAGVVKMIQAITHATLPATLHVD
QPSPHIDWSSGTVRLLTEPIQWPNTDHPRTAAVSSFGISGTNAHLILQQPPTPDTTQTPN
TTTGSDPAVGSDPAVGVLVWPLSARSAPGLSAQAARLYQHLSAHPDLDPIDVAHSLATTR
SHHPHRATITTSIEHHSENNHDTTDALAALHALANNGTHPLLSRGLLTPQGPGKTVFVFP
GQGSQYPGMGADLYRQFPVFAHALDACDAALQPFTGWSVLAVLHDEPEAPSLERVDVVQP
VLFSVMVSLAALWRWAGITPDAVIGHSQGEIAAAHVAGALTLPEAAAVVALRSRVLTDLA
GAGAMASVLSPEEPLTQLLARWDGKITVAAVNGPASAVVSGDTTAITELLITCEHENIDA
RAIPVDYPSHSPYMEHIRHQFLDELPELTPRPSTIAMYSTVDGEPHDTAYDTTTMTADYW
YRNIRNTVRFHDTVAALLGAGEQVFLELSPHPVLTQAITDTVEQAGGGGAAVPALRKDRP
DAVAFAAALGQLHCHGISPSWNVLYCQARPLTLPTYAFQHQRYWLLPTAGDFSGANTHAM
HPLLDTATELAENRGWVFTGRISPRTQPWLNEHAVESAVLFPGTGFVELALHVADRAGYS
SVNELIVHTPLLLAGHDTADLQITVTDTDDMGRQSLNIHSHPHIGHDNTTTGDEQPEWVL
HASAVLTAQTTDHNHLPLTPVPWPPPGTAAIEVDDFYDDLAAQGYNYGPTFQGVQRIWRD
HATPDVIYAEVELPEDTDIDGYGIHPALFDAALHPLLALTQPPTNDTDDTNTADTGDQVR
LPYAFTGISLHATHATRLRVRLTRTGADAITVHTSDTTGAPVAIIDSLITRPLTTATGSA
PATTAAGLLHLSWPPHPDTTTDTDTDTDALRYQVIAEPTQQLPRYLHDLHTSTDLHTSTT
EADVVVWPVPVPSNEELQAHQASDTAVSSRIHTLTRQTLTVVQDWLTHPDTTGTRLVIVT
RHGVSTSAHDPVPDLAHAAVWGLIRSAQNEHPGRFTLLDTDDNTNSDTLTTALTLPTREN
QLAIRRDTIHIPRLTRTAVLTPPDSGPWRLDTTGKGDLANLALLPTAHTALASGQIRIDV
RAAGLNFHDVVVALGLIPDDGFGGEAAGVISEIGPDVYGFAVGDAVTGMTVSGAFAPSTV
ADHRMVMTIPARWSFPQAASIPVVFLTAYIALAEISGLSRGQRVLIHAGTGGVGMAAIQL
AHHLGAEVFATASAAKWSTLEALGVPRDHIASSRTLDFSNAFLDATNGAGVDVVLNCLSG
EFVEASLALLPRGGHFVEIGKTDIRDTEVIAATHPGVIYRALDLLSVSPDHIQRTLAQLS
PLFATDTLKPLPTTNYSIYQAISALRDMSQARHTGKIVLTAPVVVDPEGTVLITGGTGTL
GALFAEHLVSAHGVRHLLLTSRRGPQAHGATDLQQRLTDLGAHVTITACDISDPEALAAL
VNSVPTQHRLTAVVHTAAVLADTPVTELTGDQLDQVLAPKIDAAWQLHQLTYEHNLSAFI
MFSSMAGMIGSPGQGNYAAANTALDALADYRHRLGLPATSLAWGYWQTHTGLTAHLTDVD
LARMTRLGLMPIATSHGLALFDAALATGQPVSIPAPINTHTLARHARDNTLAPILSALIT
TPRRRAASAATDLAARLNGLSPQQQQQTLATLVAAATATVLGHHTPESISPATAFKDLGI
DSLTALELRNTLTHNTGLNLSSTLIFDHPTPHAVAEHLLEQIPGIGALVPAPVVIAAGRT
EEPVAVVGMACRFPGGVASADQLWDLVIAGRDVVGNFPADRGWDVEGLFDPDPDAVGKTY
TRYGAFLDDAAGFDAGFFGISPREARAMDPQQRLLLEVCWEALETAGIPAHTLAGTSTGV
FVGAGAQSYGATNSDDAEGYAMTGGATSVMSGRIAYTLGLEGPAITVDTACSSSLVAIHL
ACQSLRNNESQLALAGGVTVMSTPAVFTEFSRQRGLAPDGRCKAFAATADGTGFGEGAAV
LVLERLSEARRNNHPVLAIVAGSAINQDGASNGLTAPHGPSQQRVINQALANAGLTHDQV
DAVEAHGTGTTLGDPIEAGALHATYGHHHTPDQPLWLGSIKSNIGHTQAAAGAAGVVKMI
QAITHATLPATLHVDQPSPHIDWSSGTVRLLTEPIQWPNTDHPRTAAVSSFGISGTNAHL
ILQQPPTPNPTQTPEDCSPAQSPCATITDAGTGLSFVPWVISAKSAEALSAQASRLLTRL
DDDPVVDAIDLGWSLIATRSMFEHRAVVVGADRHQLQRGLAELASGNLGADVVVGRARAA
GETVMVFPGQGSQRLGMGAQLYEQFPVFAAAFDDVVDALDQYLRLPLRQVMWGDDEGLLN
STEFAQPSLFAVEVALFALLRFWGVVPDYVIGHSVGELAAAQVAGVLSLQDAAKLVSARG
RLMQALPAGGAMVAVAASQHEVEPLLVEGVDIAALNAPGSVVISGDQAAVRLIANRLADR
GYRAHELAVSHAFHSSLMEPMLEEFARLASEIVVEQPQIPLISNVTGQLANADYGSAGYW
VDHIRRPVRFADSVASLEAMGASCFIEVGPASGLGAAIEQSLKSAEPTVSVSALSTDKPE
SVAVLRAAARLSTSGIPVDWQSVFDGRSTQTVNLPTYAFQRQRFWLDANRIGQGDPASQP
QAQNVESRFWEAVEREDVDGLADSIGVTASAMQTVLPALSSWRRAERTQSELDSWRYQVT
WLSSPATPSSITLSGIWLLIVPSELAKTDPVIGCAAALEAHGALVTIITIFEPDFNRSLM
GASLKDIGSHISGVISFLGIHGSEFSDSGAVKTLNLVQAMGDVHLDVPLWCLTQGAVSIS
ADDLIRCSSAALVWGLGRVVALEHPGSWGGLVDLPESPDDAAWERLCALLAQPTDEDQFA
IRPSGVFLRRLIHAPATTTSKSSTAWAPRGTVLITGGTGALGAHVARWLAHKYESVDLLL
TSRRGMAADGATELVDDLRTAGASVTVHACDVTDRTSVEAAIAGKSLDAVFHLAGRHQPT
LLTELEDESFSDELAPKVHGAQVLSDITSNLTLSAFVMFSSVAGIWGGKSQGAYAAANAF
LDSLAEKRRTLGLPATSVAWGLWAGGGMGDRPSASGLNLIGLKSMSADLAVQALSDAIDR
PQATLTVASVNWDRFYPTFALARPRPFLHEITEVMAYRESMRSSSASTATLLTSKLAGLT
ATEQRAVTRKLVLDQAASVLGYASTESLDTHESFKDLGFDSLTALELRDHLQTATGLNLS
STLIFDHPTPHAVAEHLLEQIPGIGALVPAPVVIAAGRTEEPVAVVGMACRFPGGVASAD
QLWDLVIAGRDVVGNFPADRGWDVEGLFDPDPDAVGKTYTRYGAFLDDAAGFDAGFFGIS
PREARAMDPQQRLLLEVCWEALETAGIPAHTLAGTSTGVFAGAWAQSYGATNSDDAEGYA
MTGGSTSVMSGRIAYTLGLEGPAITVDTACSSSLVAIHLACQSLRNNESQLALAGGVTVM
STPAIFTEFSRQRGLAPDGRCKAFAATADGTGFGEGAAVLVLERLSEARRNNHPVLAIVA
GSAINQDGASNGLTAPHGPSQQRVINQALANAGLTHDQVDAVEAHGTGTTLGDPIEASAL
HATYGHHHTPDQPLWLGSIKSNIGHTQAAAGAAGVVKMIQAITHATLPATLHVDQPSPHI
DWSSGTVRLLTEPIQWPNTDHPRTAAVSSFGISGTNAHLILQQPPTPDTTQTPNTTTGSD
PAVGSDPAVGVLVWPLSARSAPGLSAQAARLYQHLSAHPDLDPIDVAHSLATTRSHHPHR
ATITTSIEHHSENNHDTTDALAALHALANNGTHPLLSRGLLTPQGPGKTVFVFPGQGSQY
PGMGADLYRQFPVFAHALDACDAALQPFTGWSVLAVLHDEPEAPSLERVDVVQPVLFSVM
VSLAALWRWAGITPDAVIGHSQGEIAAAHVAGALTLPEAAAVVALRSRVLTDLAGAGAMA
SVLSPEEPLTQLLARWDGKITVAAVNGPASAVVSGDTTAITELLITCEHENIDARAIPVD
YPSHSPYMEHIRHQFLDELPELTPRPSTIAMYSTVDGEPHDTAYDTTTMTADYWYRNIRN
TVRFHDTVAALLGAGEQVFLELSPHPVLTQAITDTVEQAGGGGAAVPALRKDRPDAVAFA
AALGQLHCHGISPSWNVLYCQARPLTLPTYAFQHQRYWLLPTAGDFSGANTHAMHPLLDT
ATELAENRGWVFTGRISPRTQPWLNEHAVESAVLFPGTGFVELALHVADRAGYSSVNELI
VHTPLLLAGHDTADLQITVTDTDDMGRQSLNIHSHPHIGHDNTTTGDEQPEWVLHASAVL
TAQTTDHNHLPLTPVPWPPPGTAAIEVDDFYDDLAAQGYNYGPTFQGVQRIWRDHATPDV
IYAEVELPEDTDIDGYGIHPALFDAALHPLLALTQPPTNDTDDTNTADTGDQVRLPYAFT
GISLHATHATRLRVRLTRTGADAITVHTSDTTGAPVAIIDSLITRPLTTATGSAPATTAA
GLLHLSWPPHPDTTTDTDTDTDALRYQVIAEPTQQLPRYLHDLHTSTTEADVVVWPVPVP
SNEELQAHQASDTAVSSRIHTLTRQTLTVVQDWLTHPDTTGTRLVIVTRHGVSTSAHDPV
PDLAHAAVWGLIRSAQNEHPGRFTLLDTDDNTNSDTLTTALTLPTRENQLAIRRDTIHIP
RLTRHSSDGALTAPVVVDPEGTVLITGGTGTLGALFAEHLVSAHGVRHLLLTSRRGPQAH
GATDLQQRLTDLGAHVTITACDISDPEALAALVNSVPTQHRLTAVVHTAAVLADTPVTEL
TGDQLDQVLAPKIDAAWQLHQLTYEHNLSAFIMFSSMAGMIGSPGQGNYAAANTALDALA
DYRHRLGLPATSLAWGYWQTHTGLTAHLTDVDLARMTRLGLMPIATSHGLALFDAALATG
QPVSIPAPINTHTLARHARDNTLAPILSALITTPRRRAASAATDLAARLNGLSPQQQQQT
LATLVAAATATVLGHHTPESISPATAFKDLGIDSLTALELRNTLTHNTGLDLPPTLIFDH
PTPHAVAEHLLEQIPGIGALVPAPVVIAAGRTEEPVAVVGMACRFPGGVASADQLWDLVI
AGRDVVGNFPADRGWDVEGLFDPDPDAVGKTYTRYGAFLDDAAGFDAGFFGISPREARAM
DPQQRLLLEVCWEALETAGIPAHTLAGTSTGVFAGAWAQSYGATNSDDAEGYAMTGGSTS
VMSGRIAYTLGLEGPAITVDTACSSSLVAIHLACQSLRNNESQLALAGGVTVMSTPAVFT
EFSRQRGLAPDGRCKAFAATADGTGFGEGAAVLVLERLSEARRNNHPVLAIVAGSAINQD
GASNGLTAPHGPSQQRVINQALANAGLTHDQVDAVEAHGTGTTLGDPIEASALHATYGHH
HTPDQPLWLGSIKSNIGHTQAAAGAAGVVKMIQAITHATLPATLHVDQPSPHIDWSSGTV
RLLTEPIQWPNTDHPRTAAVSSFGISGTNAHLILQQPPTPDTTQTPNTTTGSDPAVGSDP
AVGVLVWPLSARSAPGLSAQAARLYQHLSAHPDLDPIDVAHSLATTRSHHPHRATITTSI
EHHSENNHDTTDALAALHALANNGTHPLLSRGLLTPQGPGKTVFVFPGQGSQYPGMGADL
YRQFPVFAHALDACDAALQPFTGWSVLAVLHDEPEAPSLERVDVVQPVLFSVMVSLAALW
RWAGITPDAVIGHSQGEIAAAHVAGALTLPEAAAVVALRSRVLTDLAGAGAMASVLSPEE
PLTQLLARWDGKITVAAVNGPASAVVSGDTTAITELLITCEHENIDARAIPVDYPSHSPY
MEHIRHQFLDELPELTPRPSTIAMYSTVDGEPHDTAYDTTTMTADYWYRNIRNTVRFHDT
VAALLGAGEQVFLELSPHPVLTQAITDTVEQAGGGGAAVPALRKDRPDAVAFAAALGQLH
CHGISPSWNVLYCQARPLTLPTYAFQHQRYWLLPTAGDFSGANTHAMHPLLDTATELAEN
RGWVFTGRISPRTQPWLNEHAVESAVLFPGTGFVELALHVADRAGYSSVNELIVHTPLLL
AGHDTADLQITVTDTDDMGRQSLNIHSRPHIGHDNTTTGDEQPEWVLHASAVLTAQTTDH
NHLPLTPVPWPPPGTAAIEVDDFYDDLAAQGYNYGPTFQGVQRIWRDHATPDVIYAEVEL
PEDTDIDGYGIHPALFDAALHPLLALTQPPTNDTDDTNTADTGDQVRLPYAFTGISLHAT
HATRLRVRLTRTGADAITVHTSDTTGAPVAIIDSLITRPLTTATGSAPATTAAGLLHLSW
PPHPDTTTDTDTDTDALRYQVIAEPTQQLPRYLHDLHTSTDLHTSTTEADVVVWPVPVPS
NEELQAHQASDTAVSSRIHTLTRQTLTVVQDWLTHPDTTGTRLVIVTRHGVSTSAHDPVP
DLAHAAVWGLIRSAQNEHPGRFTLLDTDDNTNSDTLTTALTLPTRENQLAIRRDTIHIPR
LTRTAVLTPPDSGPWRLDTTGKGDLANLALLPTAHTALASGQIRIDVRAAGLNFHDVVVA
LGLIPDDGFGGEAAGVISEIGPDVYGFAVGDAVTGMTVSGAFAPSTVADHRMVMTIPARW
SFPQAASIPVVFLTAYIALAEISGLSRGQRVLIHAGTGGVGMAAIQLAHHLGAEVFATAS
AAKWSTLEALGVPRDHIASSRTLDFSNAFLDATNGAGVDVVLNCLSGEFVEASLALLPRG
GHFVEIGKTDIRDTEVIAATHPGVIYRALDLLSVSPDHIQRTLAQLSPLFATDTLKPLPT
TNYSIYQAISALRDMSQARHTGKIVLTAPVVVDPEGTVLITGGTGTLGALFAEHLVSAHG
VRHLLLTSRRGPQAHGATDLQQRLTDLGAHVTITACDISDPEALAALVNSVPTQHRLTAV
VHTAAVLADTPVTELTGDQLDQVLAPKIDAAWQLHQLTYEHNLSAFIMFSSMAGMIGSPG
QGNYAAANTALDALADYRHRLGLPATSLAWGYWQTRTGVTAHLTDVDLARMTRLGLMPIA
TSHGLALFDAALATGQPVSIPAPINTHTLARHARDNTLTPILSALITTPRRRAASAATDL
AARLNGLSPQQQQQTLATLVAAATATVLGHHTPESISPATAFKDLGIDSLTALELRNTLT
HNTGLDLPPTLIFDHPTPTALTQHLHTRLTTGALVPAPVVIAAGRTEEPVAVVGMACRFP
GGVASADQLWDLVIAGRDVVGNFPADRGWDVAGLFDPDPDAVGKTYTRYGAFLDDAAGFD
AGFFGISPREARAMDPQQRLLLEVCWEALETAGIPAHTLAGTSTGVFVGAGAQSYGATNS
DDAEGYAMTGGAISVMSGRIAYTLGLEGPAITVDTACSSSLVAIHLACQSLRNNESQLAL
AGGVTVMSTPAVFTDFSRQRGLAPDGRCKAFAATADGTGFGEGAAVLVLERLSEARRNNH
PVLAIVAGSAINQDGASNGLTAPHGPSQQRVINQALANAGLTHDQVDAVEAHGTGTTLGD
PIEAGALHATYGHHHTPDQPLWLGSIKSNIGHTQAAAGAAGVVKMIQAITHATLPATLHV
DQPSPHIDWSSGTVRLLTEPIQWPNTDHPRTAAVSSFGISGTNAHLILQQPPTPDTTQTP
NPTTGSDPAVGSDSAVGSDPAVGVLVWPLSARSAPGLSAQAARLYQHLSAHPDLDPIDVA
HSLATTRSHHPHRATITTSIEHHSENNHDTTDALAALHALANNGTHPLLSRGLLTPQGPG
KTVFVFPGQGSQYPGMGADLYRQFPVFAHALDEVAAALNPHLDVALLEVMFSQQDTAMAQ
LLDQTFYAQPALFALGTALHRLFTHAGIHPDYLLGHSIGELTAAYAAGVLSLQDAATLVT
SRGRLMQSCTPGGTMLALQASEAEVQPLLEGLDHAVSIAAINGATSIVLSGDHDSLEQIG
EHFITQDRRTTRLQVSHAFHSPHMDPILEQFRQIAAQLTFSAPTLPILSNLTGQIARHDQ
LASPDYWTQQLRNTVRFHDTVAALLGAGEQVFLELSPHPVLTQAITDTVEQAGGGGAAVP
ALRKDRPDAVAFAAALGQLHCHGISPSWNVLYCQARPLTLPTYAFQHQRYWLLPTAGDFS
GANTHAMHPLLDTATELAENRGWVFTGRISPRTQPWLNEHAVESAVLFPNTGFVELALHV
ADRAGYSSVNELIVHTPLLLAGHDTADLQITVTDTDDMGRQSLNIHSRPHIGHDNTTTGD
EQPEWVLHASAVLTAQTTDHNHLPLTPVPWPPPGTAAIEVDDFYDDLAAQGYNYGPTFQG
VQRIWRDHATPDVIYAEVELPEDTDIDGYGIHPALFDAALHPLLALTQPPTNDTDDTNTA
DTGDQVRLPYAFTGISLHATHATRLRVRLTRTGADAITVHTSDTTGAPVAIIDSLITRPL
TTATGSAPATTAAGLLHLSWPPHPDTTTDTDTDTDTDALRYQVIAEPTQQLPRYLHDLHT
STDLHTSTTEADVVVWPVPVPSNEELQAHQASDTAVSSRIHTLTRQTLTVVQDWLTHPDT
TGTRLVIVTRHGVSTSAHDPVPDLAHAAVWGLIRSAQNEHPGRFTLLDTDDNTNSDTLTT
ALTLPTRENQLAIRRDTIHIPRLTRHSSDGALTAPVVVDPEGTVLITGGTGTLGALFAEH
LVSAHGVRHLLLTSRRGPQAHGATDLQQRLTDLGAHVTITACDISDPEALAALVNSVPTQ
HRLTAVVHTAAVLADTPVTELTGDQLDQVLAPKIDAAWQLHQLTYEHNLSAFIMFSSMAG
MIGSPGQGNYAAANTALDALADYRHRLGLPATSLAWGYWQTHTGLTAHLTDVDLARMTRL
GLMPIATSHGLALFDAALATGQPVSIPAPINTHTLARHARDNTLAPILSALITTPRRRAA
SAATDLAARLNGLSPQQQQQTLATLVAAATATVLGHHTPESISPATAFKDLGIDSLTALE
LRNTLTHNTGLDLPPTLIFDHPTPTALTQHLHTRLTQIESPNSEDSMLNLKNLDRIESYI
FRNSGEDRAHVIANRLRSILSKWDGTRSPELPAELHLESATDDELFSLANMFRTPTSEIS
PTLEGGRGVN
selected fasta
>polyketide synthase [Type I modular polyketide synthase]
GTGATCTTCGGAGATGCTCACCAAAACTGCAGGGGAGGTCGGGTGTTGGGTGATGCAGTC
GCAGTGGTCGGAATGTCTTGCCGGGTTCCTGGCGCATCTGATCCGGACGCTCTGTGGGCG
CTGCTGCGAGACGGGATCAGTGTGGTCGATGAGATACCTTCTGCACGTTGGAATTTAGAC
GGCCTCGTTGCTCACCGACTGACCGATGAGCAACGATCAGCGCTTCGGCATGGCGCCTTT
CTTGATGACGTCGAAGGGTTTGACGCCGCGTTCTTCGGAATTAACCCCTCCGAAGCTGGG
TCGATGGATCCGCAGCAACGATTGATGCTTGAACTGACCTGGGCAGCACTCGAAGATGCT
CGAATCGTGCCAGAACATCTTTCCGGTAGCAGTAGCGGGGTGTTTACCGGCGCCATGAGC
GATGATTACACGACCGCGGTGACCTACCGCGCAGCGATGACTGCACATACCTTTGCGGGG
ACTCACCGCAGCCTCATAGCCAACCGTGTCTCCTACACACTCGGTCTACGCGGACCTAGT
TTGGTCATCGATACCGGGCAATCGTCCTCACTGGTGGCTGTGCACGTGGCAATGGAAAGC
TTGCGCAGAGAAGAAACTTCACTTGCTATCGCGGGTGGTATTCACCTTAACCTCAGCCTC
GCCGCCGCACTGAGCGCAGCACACTTTGGAGCCCTTTCACCTGACGGACGCTGCTACACC
TTCGACGCACGTGCCAACGGATACGTTCGTGGCGAAGGCGGCGGCGTCGTCGTCCTCAAA
CGTCTCAACGACGCCCTAGCCGACGGCAACCATATTTACTGTGTGATCCGCGGCAGCTCA
GTCAACAACGACGGCGCCACTCAAGACTTGACAGCGCCCGGAGTCGACGGCCAGCGTCAA
GCGCTCCTTCAAGCTTATGAGCGAGCCGAAATCGACCCCTCAGAAGTCCAATACGTCGAG
CTACATGGCACCGGCACCCGACTCGGCGATCCCACCGAAGCCCACTCGCTTCACTCCGTC
TTCGGCACATCCACGGTCCCGCGCAGCCCGCTGCTAGTCGGGTCAATCAAAACCAATATC
GGTCACCTCGAAGGCGCCGCAGGAATCCTCGGCCTAATCAAGACTGCCCTTGCCGTTCAT
CATCGCCAGCTTCCCCCCAGCCTCAACTACACGGTTCCTAACCCAAAAATCCCGCTAGAG
CAGCTAGGGCTCCGCGTCCAAACCACTCTCAGTGAATGGCCGGACTTAGACAAACCGCTA
ACGGCGGGCGTGTCATCTTTTTCCATGGGTGGCACCAACGCCCACCTCATCCTCCAACAA
CCCCCCACCCCCGACACCACACAAACCCCCAACCCCACAACAGGTTCTGATCCCGCAGTG
GGTTCTGATCCCGCAGTGGGTGTACTGGTGTGGCCGTTGTCAGCGCGTTCAGCGCCGGGG
TTAAGCGCACAAGCGGCCCGTCTGTACCAGCATCTCAGCGCCCACCCCGATCTGGATCCG
ATCGATGTAGCCCACAGCCTGGCTACCACACGCAGCCACCACCCCCACCGCGCCACCATC
ACCACCAGCATTGAGCACCACAGCGAAAACAACCACGACACAACCGATGCGCTGGCCGCA
CTGCACGCCCTGGCCAACAACGGCACACACCCCCTGCTGAGCAGAGGCCTGCTGACCCCA
CAGGGCCCCGGCAAAACAGTGTTCGTGTTCCCCGGACAGGGCAGTCAATACCCCGGCATG
GGCGCAGATCTCTACCGCCAATTCCCCGTGTTCGCCCACGCCCTCGACGAGGTCGCTGCG
GCGCTGAACCCGCATCTCGATGTTGCGTTGCTTGAGGTGATGTTCAGCCAACAAGACACT
GCCATGGCGCAACTGCTGGACCAGACCTTCTATGCACAACCGGCGTTGTTCGCGCTGGGA
ACCGCTCTACATCGATTGTTCACCCACGCCGGTATCCACCCGGACTACCTGCTAGGCCAC
TCCATCGGAGAACTCACCGCGGCATACGCCGCCGGTGTGCTGTCACTGCAAGACGCAGCC
ACCTTGGTCACAAGCCGAGGACGACTGATGCAATCCTGCACGCCCGGCGGGACGATGCTC
GCACTACAAGCCAGCGAAGCAGAAGTACAACCGCTGCTTGAAGGCCTAGACCACGCCGTG
TCCATCGCCGCGATCAACGGAGCAACGTCGATCGTACTGTCAGGAGATCACGACAGCCTC
GAACAAATCGGCGAGCACTTCATTACCCAAGATCGACGTACCACCCGACTGCAGGTCAGT
CACGCTTTCCACTCTCCACATATGGACCCCATCCTCGAACAATTCCGCCAGATCGCGGCC
CAACTCACCTTCAGCGCACCCACCCTGCCCATCTTGTCCAACCTCACCGGGCAGATCGCC
CGCCACGACCAACTCGCCTCACCTGACTATTGGACCCAACAGCTACGTAACACTGTCCGG
TTCCATGACACTGTCGCTGCCCTGCTCGGGGCGGGTGAGCAGGTTTTCCTGGAACTTTCA
CCTCACCCGGTGTTGACACAAGCGATCACCGACACCGTCGAACAAGCCGGCGGCGGCGGC
GCAGCAGTGCCAGCTCTACGCAAGGATCGCCCTGATGCTGTCGCGTTCGCTGCAGCACTC
GGCCAGCTGCACTGCCATGGCATCAGCCCATCCTGGAATGTTCTTTACTGCCAGGCCCGC
CCCCTCACACTGCCCACCTACGCTTTCCAGCATCAGCGTTACTGGCTGCTGCCCACCGCT
GGTGATTTCAGCGGGGCCAATACCCACGCCATGCATCCGCTGCTAGACACCGCCACCGAA
CTGGCCGAAAACCGCGGATGGGTGTTCACCGGCCGGATCAGCCCACGCACCCAACCATGG
CTAAACGAACACGCCGTCGAATCAGCCGTGCTGTTCCCGAACACCGGATTTGTCGAGCTA
GCGCTGCATGTCGCTGACCGTGCCGGATATTCCTCGGTCAACGAACTGATCGTGCACACC
CCCCTGCTGCTCGCTGGCCACGACACCGCGGATCTACAGATCACCGTCACCGACACCGAT
GACATGGGCCGGCAGTCTCTTAACATCCACTCGCACCCACATATCGGCCATGACAACACC
ACCACCGGCGATGAACAACCCGAGTGGGTCCTGCATGCCAGCGCAGTCCTGACCGCACAA
ACCACCGACCACAACCACCTCCCCCTAACGCCTGTGCCGTGGCCTCCACCCGGCACAGCC
GCGATCGAGGTGGATGACTTCTACGACGACCTGGCTGCACAGGGCTACAACTACGGCCCG
ACATTCCAAGGTGTGCAACGGATATGGCGTGACCACGCCACACCCGATGTCATCTACGCC
GAAGTTGAACTACCCGAAGACACCGACATCGACGGCTACGGCATCCACCCCGCCCTATTC
GACGCCGCTTTACACCCCCTACTCGCCCTGACCCAACCCCCCACCAACGACACCGATGAC
ACCAACACCGCAGACACCGGGGACCAGGTGCGGCTGCCCTACGCCTTTACCGGCATCAGT
TTGCACGCCACCCACGCCACCCGATTGCGGGTACGGCTGACCCGTACCGGCGCCGATGCC
ATCACCGTGCACACCAGTGACACCACCGGAGCCCCGGTGGCGATCATCGACTCATTGATC
ACCCGCCCCCTCACCACCGCCACAGGGTCTGCTCCGGCAACCACAGCAGCTGGCCTACTA
CACCTGAGCTGGCCACCACACCCTGACACCACGACCGACACCGACACCGACACCGATGCC
CTGCGGTATCAGGTGATCGCCGAACCCACTCAACAACTGCCCCGCTACCTGCACGACCTA
CACACCAGCACCGACCTGCACACCAGCACCACCGAAGCAGACGTGGTTGTGTGGCCGGTA
CCGGTGCCCAGCAACGAAGAGCTCCAGGCACACCAAGCATCCGACACCGCGGTGTCTTCT
CGGATACACACCCTGACCCGCCAAACACTTACCGTGGTGCAGGACTGGCTCACTCACCCC
GACACCACCGGCACCCGACTGGTCATCGTGACCCGCCACGGCGTCAGCACCAGTGCCCAC
GACCCGGTCCCCGACCTAGCCCACGCCGCAGTGTGGGGCCTGATCCGCAGCGCCCAAAAC
GAACACCCCGGACGCTTCACACTGCTCGACACCGACGACAACACCAACAGCGACACCCTC
ACCACCGCCCTAACCCTGCCAACCCGCGAAAACCAACTGGCCATACGCCGCGACACCATC
CACATCCCCCGCCTGACCCGACACAGCAGTGACGGTGCGCTCACTGCGCCGGTGGTGGTA
GATCCTGAGGGCACGGTGTTGATCACCGGGGGGACCGGGACGCTGGGTGCCTTGTTCGCC
GAGCATCTGGTTTCTGCCCATGGTGTCCGGCATCTGTTGTTGACCTCGCGGCGCGGACCT
CAGGCCCACGGTGCCACCGATCTGCAGCAGCGGCTCACCGATCTAGGTGCTCATGTCACC
ATCACGGCCTGCGATATCAGCGACCCCGAAGCACTGGCCGCCCTGGTCAATTCAGTGCCC
ACACAACACCGTTTAACCGCGGTAGTGCACACCGCCGCGGTATTGGCCGACACCCCGGTC
ACCGAGTTGACCGGCGATCAACTCGACCAGGTGCTGGCCCCCAAAATCGACGCGGCATGG
CAGCTGCACCAACTCACCTACGAACACAACCTGTCTGCATTCATCATGTTCTCGTCCATG
GCCGGAATGATAGGCAGTCCCGGTCAGGGTAACTACGCGGCAGCCAACACCGCGTTAGAT
GCTCTCGCCGACTACCGCCACCGCCTGGGCTTGCCCGCGACCAGCCTGGCCTGGGGCTAC
TGGCAGACTCACACCGGTCTCACCGCGCATCTAACCGATGTAGATCTAGCCCGCATGACC
CGCCTGGGTTTGATGCCCATCGCCACCAGCCACGGACTGGCCCTGTTCGATGCCGCCCTC
GCCACCGGACAGCCCGTTTCGATACCCGCCCCGATCAACACCCACACCCTGGCCCGACAC
GCCCGCGACAACACCCTGGCCCCGATCCTGTCTGCGCTGATCACCACACCACGGCGCCGG
GCGGCCTCTGCCGCAACCGATCTCGCTGCCCGCCTCAACGGACTTAGCCCCCAACAGCAA
CAACAAACACTGGCCACCCTCGTGGCCGCGGCCACCGCCACCGTGCTGGGCCACCACACC
CCCGAAAGCATCAGCCCAGCCACCGCGTTCAAAGACCTCGGAATCGATTCGCTGACCGCC
CTTGAACTGCGCAACACCCTCACCCACAACACCGGCCTCAACCTTTCGTCCACTCTTATC
TTCGATCACCCCACACCCCATGCGGTGGCCGAGCATCTGCTTGAACAGATCCCTGGCATC
GGTGCCCTGGTGCCGGCTCCGGTGGTGATCGCAGCTGGTCGTACCGAGGAGCCGGTGGCG
GTGGTGGGGATGGCGTGTCGTTTCCCCGGTGGTGTCGCATCAGCGGATCAGTTGTGGGAC
TTGGTGATCGCTGGCCGTGATGTGGTGGGTAATTTTCCGGCCGATCGGGGTTGGGATGTG
GAGGGACTGTTTGATCCCGATCCGGACGCGGTCGGCAAAACCTACACCCGTTACGGCGCG
TTCCTTGACGATGCGGCAGGTTTTGATGCCGGGTTCTTTGGGATCTCTCCACGGGAGGCA
CGCGCGATGGACCCCCAGCAGCGGCTGCTGCTGGAGGTGTGCTGGGAAGCGCTAGAAACC
GCGGGTATTCCCGCGCACACCTTGGCCGGCACCTCCACCGGGGTATTCGTCGGAGCCTGG
GCCCAGTCCTACGGCGCCACCAACTCCGATGACGCTGAGGGGTATGCGATGACCGGCGGC
GCGACTAGCGTCATGTCCGGCCGTATCGCCTACACCTTGGGCCTAGAAGGTCCAGCGATC
ACCGTTGACACCGCCTGCTCGTCATCGCTGGTGGCAATTCACCTGGCCTGCCAATCCTTA
CGCAACAACGAATCCCAGCTAGCACTGGCCGGCGGCGTCACCGTGATGAGCACACCTGCG
GTTTTCACCGATTTCTCCCGCCAACGCGGCCTGGCCCCAGATGGACGCTGCAAAGCCTTC
GCCGCTACCGCCGATGGCACCGGCTGGGGTGAAGGCGCCGCGGTCTTGGTCCTTGAACGG
CTCTCCGAGGCCCGCCGCAACAACCACCCGGTCCTTGCGATCGTCGCTGGATCGGCGATC
AACCAAGACGGCGCATCCAACGGACTGACCGCACCCCACGGCCCGTCACAACAACGCGTC
ATCAACCAAGCACTAGCCAACGCCGGCCTCACCCACGACCAGGTCGACGCCGTCGAAGCC
CACGGCACCGGCACCACACTGGGTGACCCCATCGAAGCCGGCGCCCTACACGCCACCTAC
GGCCACCACCACACGCCCGATCAACCGCTTTGGCTGGGATCCATCAAATCCAACATCGGC
CACACCCAAGCCGCCGCCGGCGCCGCCGGTGTGGTCAAGATGATCCAAGCCATCACCCAC
GCCACCTTGCCCGCCACCTTGCACGTCGACCAACCCAGCCCCCACATCGACTGGTCCAGC
GGCACAGTCCGACTCCTAACCGAGCCCATCCAATGGCCCAACACCGACCACCCCCGCACC
GCGGCGGTGTCCTCATTCGGCATCAGCGGCACCAACGCCCACCTCATCCTCCAACAACCC
CCCACCCCCGACACCACACAAACCCCCAACCCCACAACAGGTTCTGATCCCGCAGTGGGT
TCTGATTCCGCAGTGGGTTCTGATCCCGCAGTGGGTGTACTGGTGTGGCCGTTGTCAGCG
CGTTCAGCGCCGGGGTTAAGCGCACAAGCGGCCCGTCTGTACCAGCATCTCAGCGCCCAC
CCCGATCTGGATCCGATCGATGTAGCCCACAGCCTGGCTACCACACGCAGCCACCACCCC
CACCGCGCCACCATCACCACCAGCATTGAGCACCACAGCGAAAACAACCACGACACAACC
GATGCGCTGGCCGCACTGCACGCCCTGGCCAACAACGGCACACACCCCCTGCTGAGCAGA
GGCCTGCTGACCCCACAGGGCCCCGGCAAAACAGTGTTCGTGTTCCCCGGACAGGGCAGT
CAATACCCCGGCATGGGCGCAGATCTCTACCGCCAATTCCCCGTGTTCGCCCACGCCCTC
GACGAGGTCGCTGCGGCGCTGAACCCGCATCTCGATGTTGCGTTGCTTGAGGTGATGTTC
AGCCAACAAGACACTGCCATGGCGCAACTGCTGGACCAGACCTTCTATGCACAACCGGCG
TTGTTCGCGCTGGGAACCGCTCTACATCGATTGTTCACCCACGCCGGTATCCACCCGGAC
TACCTGCTAGGCCACTCCATCGGAGAACTCACCGCGGCATACGCCGCCGGTGTGCTGTCA
CTGCAAGACGCAGCCACCTTGGTCACAAGCCGAGGACGACTGATGCAATCCTGCACGCCC
GGCGGGACGATGCTCGCACTACAAGCCAGCGAAGCAGAAGTACAACCGCTGCTTGAAGGC
CTAGACCACGCCGTGTCCATCGCCGCGATCAACGGAGCAACGTCGATCGTACTGTCAGGA
GATCACGACAGCCTCGAACAAATCGGCGAGCACTTCATTACCCAAGATCGACGTACCACC
CGACTGCAGGTCAGTCACGCTTTCCACTCTCCACATATGGACCCCATCCTCGAACAATTC
CGCCAGATCGCGGCCCAACTCACCTTCAGCGCACCCACCCTGCCCATCTTGTCCAACCTC
ACCGGGCAGATCGCCCGCCACGACCAACTCGCCTCACCTGACTATTGGACCCAACAGCTA
CGTAACACTGTCCGGTTCCATGACACTGTCGCTGCCCTGCTCGGGGCGGGTGAGCAGGTT
TTCCTGGAACTTTCACCTCACCCGGTGTTGACACAAGCGATCACCGACACCGTCGAACAA
GCCGGCGGCGGCGGCGCAGCAGTGCCAGCTCTACGCAAGGATCGCCCTGATGCTGTCGCG
TTCGCTGCAGCACTCGGCCAGCTGCACTGCCATGGCATCAGCCCATCCTGGAATGTTCTT
TACTGCCAGGCCCGCCCCCTCACACTGCCCACCTACGCTTTCCAGCATCAGCGTTACTGG
CTGCTGCCCACCGCTGGTGATTTCAGCGGGGCCAATACCCACGCCATGCATCCGCTGCTA
GACACCGCCACCGAACTGGCCGAAAACCGCGGATGGGTGTTCACCGGCCGGATCAGCCCA
CGCACCCAACCATGGCTAAACGAACACGCCGTCGAATCAGCCGTGCTGTTCCCGAACACC
GGATTTGTCGAGCTAGCGCTGCATGTCGCTGACCGTGCCGGATATTCCTCGGTCAACGAA
CTGATCGTGCACACCCCCCTGCTACTCGCTGGCCACGACACCGCGGATCTACAGATCACC
GTCACCGACACCGATGACATGGGCCGGCAGTCTCTTAACATCCACTCGCGCCCACATATC
GGCCATGACAACACCACCACCGGCGATGAACAACCCGAGTGGGTCCTGCATGCCAGCGCA
GTCCTGACCGCACAAACCACCGACCACAACCACCTCCCCCTAACGCCTGTGCCGTGGCCT
CCACCCGGCACAGCCGCGATCGAGGTGGATGACTTCTACGACGACCTGGCTGCACAGGGC
TACAACTACGGCCCGACATTCCAAGGTGTGCAACGGATATGGCGTGACCACGCCACACCC
GATGTCATCTACGCCGAAGTTGAACTACCCGAAGACACCGACATCGACGGCTACGGCATC
CACCCCGCCCTATTCGACGCCGCTTTACACCCCCTACTCGCCCTGACCCAACCCCCCACC
AACGACACCGATGACACCAACACCGCAGACACCGGTGACCAGGTGCGGCTGCCCTACGCC
TTTACCGGCATCAGTTTGCACGCCACCCACGCCACCCGATTGCGGGTACGGCTGACCCGT
ACCGGCGCCGATGCCATCACCGTGCACACCAGTGACACCACCGGAGCCCCGGTGGCGATC
ATCGACTCATTGATCACCCGCCCCCTCACCACCGCCACAGGGTCTGCTCCGGCAACCACA
GCAGCTGGCCTACTACACCTGAGCTGGCCACCACACCCTGACACCACGACCGACACCGAC
ACCGACACCGATGCCCTGCGGTATCAGGTGATCGCCGAACCCACTCAACAACTGCCCCGC
TACCTGCACGACCTACACACCAGCACCGACCTGCACACCAGCACCACCGAAGCAGACGTG
GTTGTGTGGCCGGTACCGGTGCCCAGCAACGAAGAGCTCCAGGCACACCAAGCATCCGAC
ACCGCGGTGTCTTCTCGGATACACACCCTGACCCGCCAAACACTTACCGTGGTGCAGGAC
TGGCTCACTCACCCCGACACCACCGGCACCCGACTGGTCATCGTGACCCGCCACGGCGTC
AGCACCAGTGCCCACGACCCGGTCCCCGACCTAGCCCACGCCGCAGTGTGGGGCCTGATC
CGCAGCGCCCAAAACGAACACCCCGGACGCTTCACACTGCTCGACACCGACGACAACACC
AACAGCGACACCCTCACCACCGCCCTAACCCTGCCAACCCGCGAAAACCAACTGGCCATA
CGCCGCGACACCATCCACATCCCCCGCCTGACCCGACACAGCAGTGACGGTGCGCTCACT
GCGCCGGTGGTGGTAGATCCTGAGGGCACGGTGTTGATCACCGGGGGGACCGGGACGCTG
GGTGCCTTGTTCGCCGAGCATCTGGTTTCTGCCCATGGTGTCCGGCATCTGTTGTTGACC
TCGCGGCGCGGACCTCAGGCCCACGGTGCCACCGATCTGCAGCAGCGGCTCACCGATCTA
GGTGCTCATGTCACCATCACGGCCTGCGATATCAGCGACCCCGAAGCACTGGCCGCCCTG
GTCAATTCAGTGCCCACACAACACCGTTTAACCGCGGTAGTGCACACCGCCGCGGTATTG
GCCGACACCCCGGTCACCGAGTTGACCGGCGATCAACTCGACCAGGTGCTGGCCCCCAAA
ATCGACGCGGCATGGCAGCTGCACCAACTCACCTACGAACACAACCTGTCTGCATTCATC
ATGTTCTCGTCCATGGCCGGAATGATAGGCAGTCCCGGTCAGGGTAACTACGCGGCAGCC
AACACCGCGTTAGATGCTCTCGCCGACTACCGCCACCGCCTGGGCTTGCCCGCGACCAGC
CTGGCCTGGGGCTACTGGCAGACTCACACCGGTCTCACCGCGCATCTAACCGATGTAGAT
CTAGCCCGCATGACCCGCCTGGGTTTGATGCCCATCGCCACCAGCCACGGACTGGCCCTG
TTCGATGCCGCCCTCGCCACCGGACAGCCCGTTTCGATACCCGCCCCGATCAACACCCAC
ACCCTGGCCCGACACGCCCGCGACAACACCCTGGCCCCGATCCTGTCTGCGCTGATCACC
ACACCACGGCGCCGGGCGGCCTCTGCCGCAACCGATCTCGCTGCCCGCCTCAACGGACTT
AGCCCCCAACAGCAACAACAAACACTGGCCACCCTCGTGGCCGCGGCCACCGCCACCGTG
CTGGGCCACCACACCCCCGAAAGCATCAGCCCAGCCACCGCGTTCAAAGACCTCGGAATC
GATTCGCTGACCGCCCTTGAACTGCGCAACACCCTCACCCACAACACCGGCCTCAACCTT
TCGTCCACTCTTATCTTCGATCACCCCACACCCCATGCGGTGGCCGAGCATCTGCTTGAA
CAGATCCCTGGCATCGGTGCCCTGGTGCCGGCTCCGGTGGTGATCGCAGCTGGTCGTACC
GAGGAGCCGGTGGCGGTGGTGGGGATGGCGTGTCGTTTCCCCGGTGGTGTCGCATCAGCG
GATCAGTTGTGGGACTTGGTGATCGCTGGCCGTGATGTGGTGGGTAATTTTCCGGCCGAT
CGGGGTTGGGATGTGGAGGGACTGTTTGATCCCGATCCGGACGCGGTCGGCAAAACCTAC
ACCCGTTACGGCGCGTTCCTTGACGATGCGGCAGGTTTTGATGCCGGGTTCTTTGGGATC
TCTCCACGGGAGGCACGCGCGATGGACCCCCAGCAGCGGCTGCTGCTGGAGGTGTGCTGG
GAAGCGCTAGAAACCGCGGGTATTCCCGCGCACACCTTGGCCGGCACCTCCACCGGGGTA
TTCGTCGGAGCCGGGGCCCAGTCCTACGGCGCCACCAACTCCGATGACGCTGAGGGGTAT
GCGATGACCGGCGGCGCGACTAGCGTCATGTCCGGCCGTATCGCCTACACCTTGGGCCTA
GAAGGTCCAGCGATCACCGTTGACACCGCCTGCTCGTCATCGCTGGTGGCAATTCACCTG
GCCTGCCAATCCTTACGCAACAACGAATCCCAGCTAGCACTGGCCGGCGGCGTCACCGTG
ATGAGCACACCTGCGATTTTCACCGAGTTCTCCCGCCAACGCGGCCTGGCCCCAGATGGA
CGCTGCAAAGCCTTCGCCGCTACCGCCGATGGCACCGGCTGGGGTGAAGGCGCCGCGGTC
TTGGTCCTTGAACGGCTCTCCGAGGCCCGCCGCAACAACCACCCGGTCCTTGCGATCGTC
GCTGGATCGGCGATCAACCAAGACGGCGCATCCAACGGACTGACCGCACCCCACGGCCCG
TCACAACAACGCGTCATCAACCAAGCACTAGCCAACGCCGGCCTCACCCACGACCAGGTC
GACGCCGTCGAAGCCCACGGCACCGGCACCACACTGGGTGACCCCATCGAAGCCGGCGCC
CTACACGCCACCTACGGCCACCACCACACGCCCGATCAACCGCTTTGGCTGGGATCCATC
AAATCCAACATCGGCCACACCCAAGCCGCCGCCGGCGCCGCCGGTGTGGTCAAGATGATC
CAAGCCATCACCCACGCCACCTTGCCCGCCACCTTGCACGTCGACCAACCCAGCCCCCAC
ATCGACTGGTCCAGCGGCACAGTCCGACTCCTAACCGAGCCCATCCAATGGCCCAACACC
GACCACCCCCGCACCGCGGCGGTGTCCTCATTCGGCATCAGCGGCACCAACGCCCACCTC
ATCCTCCAACAACCCCCCACCCCCGACACCACACAAACCCCCAACCCCACAACAGGTTCT
GATCCCGCAGTGGGTTCTGATTCCGCAGTGGGTTCTGATCCCGCAGTGGGTGTACTGGTG
TGGCCGTTGTCAGCGCGTTCAGCGCCGGGGTTAAGCGCACAAGCGGCCCGTCTGTACCAG
CATCTCAGCGCCCACCCCGATCTGGATCCGATCGATGTAGCCCACAGCCTGGCTACCACA
CGCAGCCACCACCCCCACCGCGCCACCATCACCACCAGCATTGAGCACCACAGCGAAAAC
AACCACGACACAACCGATGCGCTGGCCGCACTGCACGCCCTGGCCAACAACGGCACACAC
CCCCTGCTGAGCAGAGGCCTGCTGACCCCACAGGGCCCCGGCAAAACAGTGTTCGTGTTC
CCCGGACAGGGCAGTCAATACCCCGGCATGGGCGCAGATCTCTACCGCCAATTCCCCGTG
TTCGCCCACGCCCTCGACGCATGCGACGCAGCGTTACAGCCTTTCACTGGATGGTCGGTG
CTAGCTGTGTTACACGACGAACCCGAGGCCCCGTCGTTGGAGCGAGTCGATGTGGTCCAG
CCTGTGTTGTTCTCGGTGATGGTGTCGTTAGCCGCACTCTGGCGGTGGGCCGGAATCACC
CCCGATGCAGTCATCGGCCACTCCCAGGGCGAGATCGCCGCGGCACATGTGGCCGGAGCC
CTGACCTTGCCCGAAGCAGCTGCGGTAGTGGCTTTGCGCAGCCGTGTCTTGACCGACCTG
GCCGGTGCCGGTGCCATGGCTTCAGTGCTATCGCCCGAGGAACCACTGACCCAGCTGCTG
GCACGGTGGGACGGCAAGATCACTGTCGCCGCAGTTAACGGCCCCGCTAGCGCTGTGGTC
TCCGGCGATACCACAGCGATCACCGAATTGCTGATTACCTGCGAACACGAAAACATCGAC
GCTCGCGCTATCCCGGTGGACTACCCCTCTCATTCCCCCTATATGGAACACATCCGCCAT
CAGTTCCTCGACGAGCTACCCGAGCTGACACCGCGGCCATCAACCATCGCGATGTATTCC
ACCGTCGACGGCGAACCTCACGACACCGCCTACGACACCACCACAATGACCGCGGACTAC
TGGTACCGCAACATCCGTAACACTGTCCGGTTCCATGACACTGTCGCTGCCCTGCTCGGG
GCGGGTGAGCAGGTTTTCCTGGAACTTTCACCTCACCCGGTGTTGACACAAGCGATCACC
GACACCGTCGAACAAGCCGGCGGCGGCGGCGCAGCAGTGCCAGCTCTACGCAAGGATCGC
CCTGATGCTGTCGCGTTCGCTGCAGCACTCGGCCAGCTGCACTGCCATGGCATCAGCCCA
TCCTGGAATGTTCTTTACTGCCAGGCCCGCCCCCTCACACTGCCCACCTACGCTTTCCAG
CATCAGCGTTACTGGCTGCTGCCCACCGCTGGTGATTTCAGCGGGGCCAATACCCACGCC
ATGCATCCGCTGCTAGACACCGCCACCGAACTGGCCGAAAACCGCGGATGGGTGTTCACC
GGCCGGATCAGCCCACGCACCCAACCATGGCTAAACGAACACGCCGTCGAATCAGCCGTG
CTGTTCCCAGGCACCGGATTCGTCGAGCTAGCGCTGCATGTCGCTGACCGTGCCGGATAT
TCCTCGGTCAACGAACTGATCGTGCACACCCCCCTGCTACTCGCTGGCCACGACACCGCG
GATCTACAGATCACCGTCACCGACACCGATGACATGGGCCGGCAGTCTCTTAACATCCAC
TCGCGCCCACATATCGGCCATGACAACACCACCACCGGCGATGAACAACCCGAGTGGGTC
CTGCATGCCAGCGCAGTCCTGACCGCACAAACCACCGACCACAACCACCTCCCCCTAACG
CCTGTGCCGTGGCCTCCACCCGGCACAGCCGCGATCGAGGTGGATGACTTCTACGACGAC
CTGGCTGCACAGGGCTACAACTACGGCCCGACATTCCAAGGTGTGCAACGGATATGGCGT
GACCACGCCACACCCGATGTCATCTACGCCGAAGTTGAACTACCCGAAGACACCGACATC
GACGGCTACGGCATCCACCCCGCCCTATTCGACGCCGCTTTACACCCCCTACTCGCCCTG
ACCCAACCCCCCACCAACGACACCGATGACACCAACACCGCAGACACCGGTGACCAGGTG
CGGCTGCCCTACGCCTTTACCGGCATCAGTTTGCACGCCACCCACGCCACCCGATTACGG
GTACGGCTGACCCGTACCGGCGCCGATGCCATCACCGTGCACACCAGTGACACCACCGGA
GCCCCGGTGGCGATCATCGACTCATTGATCACCCGCCCCCTCACCACCGCCACAGGGTCT
GCTCCGGCAACCACAGCAGCTGGCCTACTACACCTGAGCTGGCCACCACACCCTGACACC
ACGACCGACACCGACACCGACACCGATGCCCTGCGGTATCAGGTGATCGCCGAACCCACT
CAACAACTGCCCCGCTACCTGCACGACCTACACACCAGCACCGACCTGCACACCAGCACC
ACCGAAGCAGACGTGGTTGTGTGGCCGGTACCGGTGCCCAGCAACGAAGAGCTCCAGGCA
CACCAAGCATCCGACACCGCGGTGTCTTCTCGGATACACACCCTGACCCGCCAAACACTT
ACCGTGGTGCAGGACTGGCTCACTCACCCCGACACCACCGGCACCCGACTGGTCATCGTG
ACCCGCCACGGCGTCAGCACCAGTGCCCACGACCCGGTCCCCGACCTAGCCCACGCCGCA
GTGTGGGGCCTGATCCGCAGCGCCCAAAACGAACACCCCGGACGCTTCACACTGCTCGAC
ACCGACGACAACACCAACAGCGACACCCTCACCACCGCCCTAACCCTGCCAACCCGCGAA
AACCAACTGGCCATACGCCGCGACACCATCCACATCCCCCGCCTGACCCGCACCGCTGTC
CTGACACCACCGGACAGCGGCCCCTGGCGCCTTGACACCACCGGCAAGGGTGATCTGGCC
AACCTCGCCCTGCTACCGACCGCCCACACTGCCCTGGCCTCTGGACAAATCCGTATCGAT
GTCCGGGCCGCTGGTTTGAATTTTCACGACGTGGTCGTCGCGTTGGGGCTAATCCCCGAC
GACGGATTCGGCGGAGAAGCCGCCGGGGTGATCAGCGAGATCGGTCCCGACGTCTACGGA
TTCGCCGTGGGTGATGCCGTGACCGGCATGACCGTCTCTGGTGCGTTTGCCCCCAGCACT
GTCGCTGATCACCGCATGGTGATGACGATCCCGGCCCGGTGGTCCTTCCCCCAAGCCGCA
TCCATACCGGTGGTATTCCTGACCGCCTACATCGCTTTGGCCGAGATCTCGGGCCTAAGC
CGAGGGCAACGAGTGCTGATCCATGCCGGCACTGGCGGTGTGGGTATGGCTGCGATTCAA
TTGGCACACCATTTGGGTGCCGAAGTATTCGCCACCGCCAGCGCCGCGAAATGGAGCACC
CTTGAGGCACTGGGGGTACCGCGCGACCATATCGCTTCCTCGCGTACTCTGGACTTTTCC
AACGCATTCCTCGATGCCACCAACGGCGCCGGTGTTGATGTCGTATTGAACTGCCTCAGT
GGTGAATTCGTCGAAGCATCCCTAGCCCTGCTGCCCCGCGGTGGCCATTTCGTCGAAATC
GGCAAAACCGACATCCGTGATACCGAGGTCATCGCCGCAACCCATCCCGGCGTCATTTAC
CGCGCCCTCGATCTGCTCAGCGTCTCCCCCGATCACATCCAGCGCACACTGGCCCAACTG
TCCCCACTGTTTGCCACCGACACCCTAAAACCCCTACCGACCACTAATTACAGCATCTAC
CAAGCCATCTCGGCCTTACGTGACATGAGTCAAGCCCGTCACACAGGCAAGATCGTGCTC
ACTGCGCCGGTGGTGGTAGATCCTGAGGGCACGGTGTTGATCACCGGGGGGACCGGGACG
CTGGGTGCCTTGTTCGCCGAGCATCTGGTTTCTGCCCATGGTGTCCGGCATCTGTTGTTG
ACCTCGCGGCGCGGACCTCAGGCCCACGGTGCCACCGATCTGCAGCAGCGGCTCACCGAT
CTAGGTGCTCATGTCACCATCACGGCCTGCGATATCAGCGACCCCGAAGCACTGGCCGCC
CTGGTCAATTCAGTGCCCACACAACACCGTTTAACCGCGGTAGTGCACACCGCCGTGGTA
TTGGCCGACACCCCGGTCACCGAGTTGACCGGCGATCAACTCGACCAGGTGCTGGCCCCC
AAAATCGACGCGGCATGGCAGCTGCACCAACTCACCTACGAACACAACCTGTCTGCATTC
ATCATGTTCTCGTCCATGGCCGGAATGATAGGCAGTCCCGGTCTGGGTAACTACGCGGCA
GCCAACACCGCGTTAGATGCTCTCGCCGACTACCGCCACCGCCTGGGCTTGCCCGCGACC
AGCCTGGCCTGGGGCTACTGGCAGACCCGCACCGGTCTCACCGCGCATCTAACCGATGTA
GATCTAGCCCGCATGACCCGCCTGGGTTTGATGCCCATCGCCACCAGCCACGGACTGGCC
CTGTTCGATGCCGCCCTCGCCACCGGACAGCCCGTTTCGATACCCGCCCCGATCAACACC
CACACCCTGGCCCGACACGCCCGCGACAACACCCTGGCCCCGATCCTGTCTGCGCTGATC
ACCACACCACGGCGCCGGGCGGCCTCTGCCGCAACCGATCTCGCTGCCCGCCTCAACGGA
CTTAGCCCCCAACAGCAACAACAAACACTGGCCACCCTCGTGGCCGCGGCCACCGCCACC
GTGCTGGGCCACCACACCCCCGAAAGCATCAGCCCAGCCACCGCGTTCAAAGACCTCGGA
ATCGATTCGCTGACCGCCCTTGAACTGCGCAACACCCTCACCCACAACACCGGCCTCAAC
CTTTCGTCCACTCTTATCTTCGATCACCCCACACCCCATGCGGTGGCCGAGCATCTGCTT
GAACAGATCCCTGGCATCGGTGCCCTGGTGCCGGCTCCGGTGGTGATCGCAGCTGGTCGT
ACCGAGGAGCCGGTGGCGGTGGTGGGGATGGCGTGTCGTTTCCCCGGTGGTGTCGCATCA
GCGGATCAGTTGTGGGACTTGGTGATCGCTGGCCGTGATGTGGTGGGTAATTTTCCGGCC
GATCGGGGTTGGGATGTGGAGGGACTGTTTGATCCCGATCCGGACGCGGTCGGCAAAACC
TACACCCGTTACGGCGCGTTCCTTGACGATGCGGCAGGTTTTGATGCCGGGTTCTTTGGG
ATCTCTCCACGGGAGGCACGCGCGATGGACCCCCAGCAGCGGCTGCTGCTGGAGGTGTGC
TGGGAAGCGCTAGAAACCGCGGGTATTCCCGCGCACACCTTGGCCGGCACCTCCACCGGG
GTATTCGTCGGAGCCGGGGCCCAGTCCTACGGCGCCACCAACTCCGATGGCGCTGAGGGG
TATGCGATGACCGGCGGCGCGATCAGCGTCATGTCCGGCCGTATCGCCTACACCTTGGGC
CTAGAAGGTCCAGCGATCACCGTTGACACCGCCTGCTCGTCATCGCTGGTGGCAATTCAC
CTGGCCTGCCAATCCTTACGCAACAACGAATCCCAGCTAGCACTGGCCGGCGGCGTCACC
GTGATGAGCACACCTGCGATTTTCACCGAGTTCTCCCGCCAACGCGGCCTGGCCCCAGAT
GGACGCTGCAAAGCCTTCGCCGCTACCGCCGATGGCACCGGCTTTGGTGAAGGCGCCGCG
GTCTTGGTCCTTGAACGGCTCTCCGAGGCCCGCCGCAACAACCACCCGGTCCTTGCGATC
GTCGCTGGATCGGCGATCAACCAAGACGGCGCATCCAACGGACTGACCGCACCCCACGGC
CCGTCACAACAACGCGTCATCAACCAAGCACTAGCCAACGCCGGCCTCACCCACGACCAG
GTCGACGCCGTCGAAGCCCACGGCACCGGCACCACACTGGGTGACCCCATCGAAGCCAGC
GCCCTACACGCCACCTACGGCCACCACCACACGCCCGATCAACCGCTTTGGCTGGGATCC
ATCAAATCCAACATCGGCCACACCCAAGCCGCCGCCGGCGCCGCCGGTGTGGTCAAGATG
ATCCAAGCCATCACCCACGCCACCTTGCCCGCCACCTTGCACGTCGACCAACCCAGCCCC
CACATCGACTGGTCCAGCGGCACAGTCCGACTCCTAACCGAGCCCATCCAATGGCCCAAC
ACCGACCACCCCCGCACCGCGGCGGTGTCCTCATTCGGCATCAGCGGCACCAACGCCCAC
CTCATCCTCCAACAACCCCCCACCCCCGACACCACACAAACCCCCAACACCACAACAGGT
TCTGATCCCGCAGTGGGTTCTGATTCCGCAGTGGGTTCTGATCCCGCAGTGGGTGTACTG
GTGTGGCCGTTGTCAGCGCGTTCAGCGCCGGGGTTAAGCGCACAAGCGGCCCGTCTGTAC
CAGCATCTCAGCGCCCACCCCGATCTGGATCCGATCGATGTAGCCCACAGCCTGGCTACC
ACACGCAGCCACCACCCCCACCGCGCCACCATCACCACCAGCATTGAGCACCACAGCGAA
AACAACCACGACACAACCGATGCGCTGGCCGCACTGCACGCCCTGGCCAACAACGGCACA
CACCCCCTGCTGAGCAGAGGCCTGCTGACCCCACAGGGCCCCGGCAAAACAGTGTTCGTG
TTCCCCGGACAGGGCAGTCAATACCCCGGCATGGGCGCAGATCTCTACCGCCAATTCCCC
GTGTTCGCCCACGCCCTCGACGCATGCGACGCAGCGTTACAGCCTTTCACTGGATGGTCG
GTGCTAGCTGTGTTACACGACGAACCCGAGGCCCCGTCGTTGGAGCGGGTCGATGTGGTC
CAGCCTGTGTTGTTCTCGGTGATGGTGTCGTTAGCCGCACTCTGGCGGTGGGCCGGAATC
ACCCCCGATGCAGTCATCGGCCACTCCCAGGGCGAGATCGCCGCGGCACATGTGGCCGGA
GCCCTGACCTTGCCCGAAGCAGCTGCGGTAGTGGCTTTGCGCAGCCGTGTCTTGACCGAC
CTGGCCGGTGCCGGTGCCATGGCTTCAGTGCTATCGCCCGAGGAACCACTGACCCAGCTG
CTGGCACGGTGGGACGGCAAGATCACTGTCGCCGCAGTTAACGGCCCCGCTAGCGCTGTG
GTCTCCGGCGATACCACAGCGATCACCGAATTGCTGATTACCTGCGAACACGAAAACATC
GACGCTCGCGCTATCCCGGTGGACTACCCCTCTCATTCCCCCTATATGGAACACATCCGC
CATCAGTTCCTCGACGAGCTACCCGAGCTGACACCGCGGCCATCAACCATCGCGATGTAT
TCCACCGTCGACGGCGAACCTCACGACACCGCCTACGACACCACCACAATGACCGCGGAC
TACTGGTACCGCAACATCCGTAACACTGTCCGGTTCCATGACACTGTCGCTGCCCTGCTC
GGGGCGGGTGAGCAGGTTTTCCTGGAACTTTCACCTCACCCGGTGTTGACACAAGCGATC
ACCGACACCGTCGAACAAGCCGGCGGCGGCGGCGCAGCAGTGCCAGCTCTACGCAAGGAT
CGCCCTGATGCTGTCGCGTTCGCTGCAGCACTCGGCCAGCTGCACTGCCATGGCATCAGC
CCATCCTGGAATGTTCTTTACTGCCAGGCCCGCCCCCTCACACTGCCCACCTACGCTTTC
CAGCATCAGCGTTACTGGCTGCTGCCCACCGCTGGTGATTTCAGCGGGGCCAATACCCAC
GCCATGCATCCGCTGCTAGACACCGCCACCGAACTGGCCGAAAACCGCGGATGGGTGTTC
ACCGGCCGGATCAGCCCACGCACCCAACCATGGCTAAACGAACACGCCGTCGAATCAGCC
GTGCTGTTCCCAGGCACCGGATTTGTCGAGCTAGCGCTGCATGTCGCTGACCGTGCCGGA
TATTCCTCGGTCAACGAACTGATCGTGCACACCCCCCTGCTGCTCGCTGGCCACGACACC
GCGGATCTACAGATCACCGTCACCGACACCGATGACATGGGCCGGCAGTCTCTTAACATC
CACTCGCGCCCACATATCGGCCATGACAACACCACCACCGGCGATGAACAACCCGAGTGG
GTCCTGCATGCCAGCGCAGTCCTGACCGCACAAACCACCGACCACAACCACCTCCCCCTA
ACGCCTGTGCCGTGGCCTCCACCCGGCACAGCCGCGATCGAGGTGGATGACTTCTACGAC
GACCTGGCTGCACAGGGCTACAACTACGGCCCGACATTCCAAGGTGTGCAACGGATATGG
CGTGACCACGCCACACCCGATGTCATCTACGCCGAAGTTGAACTACCCGAAGACACCGAC
ATCGACGGCTACGGCATCCACCCCGCCCTATTCGACGCCGCTTTACACCCCCTACTCGCC
CTGACCCAACCCCCCACCAACGACACCGATGACACCAACACCGCAGACACCGGGGACCAG
GTGCGGCTGCCCTACGCCTTTACCGGCATCAGTTTGCACGCCACCCACGCCACCCGATTG
CGGGTACGGCTGACCCGTACCGGCGCCGATGCCATCACCGTGCACACCAGTGACACCACC
GGAGCCCCGGTGGCGATCATCGACTCATTGATCACCCGCCCCCTCACCACCGCCACAGGG
TCTGCTCCGGCAACCACAGCAGCTGGCCTACTACACCTGAGCTGGCCACCACACCCTGAC
ACCACGACCGACACCGACACCGACACCGATGCCCTGCGGTATCGGGTGATCGCCGAACCC
ACTCAACAACTGCCCCGCTACCTGCACGACCTACACACCAGCACCGACCTGCACACCAGC
ACCACCGAAGCAGACGTGGTTGTGTGGCCGGTACCGGTGCCCAGCAACGAAGAGCTCCAG
GCACACCAAGCATCCGACACCGCGGTGTCTTCTCGGATACACACCCTGACCCGCCAAACA
CTTACCGTGGTGCAGGACTGGCTCACTCACCCCGACACCACCGGCACCCGACTGGTCATC
GTGACCCGCCACGGCGTCAGCACCAGTGCCCACGACCCGGTCCCCGACCTAGCCCACGCC
GCAGTGTGGGGCCTGATCCGCAGCGCCCAAAACGAACACCCCGGACGCTTCACACTGCTC
GACACCGACGACAACACCAACAGCGACACCCTCACCACCGCCCTAACCCTGCCAACCCGC
GAAAACCAACTGGCCATACGCCGCGACACCATCCACATCCCCCGCCTGACCCGACACAGC
AGTGACGGTGCGCTCACTGCGCCGGTGGTGGTAGATCCTGAGGGCACGGTGTTGATCACC
GGGGGGACCGGGACGCTGGGTGCCTTGTTCGCCGAGCATCTGGTTTCTGCCCATGGTGTC
CGGCATCTGTTGTTGACCTCGCGGCGCGGACCTCAGGCCCACGGTGCCACCGATCTGCAG
CAGCGGCTCACCGATCTAGGTGCTCATGTCACCATCACGGCCTGCGATATCAGCGACCCC
GAAGCACTGGCCGCCCTGGTCAATTCAGTGCCCACACAACACCGTTTAACCGCGGTAGTG
CACACCGCCGCGGTATTGGCCGACACCCCGGTCACCGAGTTGACCGGCGATCAACTCGAC
CAGGTGCTGGCCCCCAAAATCGACGCGGCATGGCAGCTGCACCAACTCACCTACGAACAC
AACCTGTCTGCATTCATCATGTTCTCGTCCATGGCCGGAATGATAGGCAGTCCCGGTCAG
GGTAACTACGCGGCAGCCAACACCGCGTTAGATGCTCTCGCCGACTACCGCCACCGCCTG
GGCTTGCCCGCGACCAGCCTGGCCTGGGGCTACTGGCAGACTCACACCGGTCTCACCGCG
CATCTAACCGATGTAGATCTAGCCCGCATGACCCGCCTGGGTTTGATGCCCATCGCCACC
AGCCACGGACTGGCCCTGTTCGATGCCGCCCTCGCCACCGGACAGCCCGTTTCGATACCC
GCCCCGATCAACACCCACACCCTGGCCCGACACGCCCGCGACAACACCCTGGCCCCGATC
CTGTCTGCGCTGATCACCACACCACGGCGCCGGGCGGCCTCTGCCGCAACCGATCTCGCT
GCCCGCCTCAACGGACTTAGCCCCCAACAGCAACAACAAACACTGGCCACCCTCGTGGCC
GCGGCCACCGCCACCGTGCTGGGCCACCACACCCCCGAAAGCATCAGCCCAGCCACCGCG
TTCAAAGACCTCGGAATCGATTCGCTGACCGCCCTTGAACTGCGCAACACCCTCACCCAC
AACACCGGCCTGGATCTGCCCCCCACCCTCATCTTCGATCACCCCACACCCACCGCGCTA
ACCCAACACCTGCACACCCGACTCACCACCGGTGCCCTGGTGCCGGCTCCGGTGGTGATC
GCAGCTGGTCGTACCGAGGAGCCGGTGGCGGTGGTGGGGATGGCGTGTCGTTTCCCCGGT
GGTGTCGCATCAGCGGATCAGTTGTGGGACTTGGTGATCGCTGGCCGTGATGTGGTGGGT
AATTTTCCGGCCGATCGGGGTTGGGATGTGGAGGGACTGTTTGATCCCGATCCGGACGCG
GTCGGCAAAACCTACACCCGTTACGGCGCGTTCCTTGACGATGCGGCAGGTTTTGATGCC
GGGTTCTTTGGGATCTCTCCACGGGAGGCACGCGCGATGGACCCCCAGCAGCGGCTGCTG
CTGGAGGTGTGCTGGGAAGCGCTAGAAACCGCGGGTATTCCCGCGCACACCTTGGCCGGC
ACCTCCACCGGGGTATTCGTCGGAGCCTGGGCCCAGTCCTACGGCGCCACCAACTCCGAT
GACGCTGAGGGGTATGCGATGACCGGCGGCGCGATCAGCGTCATGTCCGGCCGTATCGCC
TACACCTTGGGCCTAGAAGGTCCAGCGATCACCGTTGACACCGCCTGCTCGTCATCGCTG
GTGGCAATTCACCTGGCCTGCCAATCCTTACGCAACAACGAATCCCAGCTAGCACTGGCC
GGCGGCGTCACCGTGATGAGCACACCTGCGGTTTTCACCGATTTCTCCCGCCAACGCGGC
CTGGCCCCAGATGGACGCTGCAAAGCCTTCGCCGCTACCGCCGATGGCACCGGCTTTGGT
GAAGGCGCCGCGGTCTTGGTCCTTGAACGGCTCTCCGAGGCCCGCCGCAACAACCACCCG
GTCCTTGCGATCGTCGCTGGATCGGCGATCAACCAAGACGGCGCATCCAACGGACTGACC
GCACCCCACGGCCCGTCACAACAACGCGTCATCAACCAAGCACTAGCCAACGCCGGCCTC
ACCCACGACCAGGTCGACGCCGTCGAAGCCCACGGCACCGGCACCACACTGGGTGACCCC
ATCGAAGCCGGCGCCCTACACGCCACCTACGGCCACCACCACACGCCCGATCAACCGCTT
TGGCTGGGATCCATCAAATCCAACATCGGCCACACCCAAGCCGCCGCCGGCGCCGCCGGT
GTGGTCAAGATGATCCAAGCCATCACCCACGCCACCTTGCCCGCCACCTTGCACGTCGAC
CAACCCAGCCCCCACATCGACTGGTCCAGCGGCACAGTCCGACTCCTAACCGAGCCCATC
CAATGGCCCAACACCGACCACCCCCGCACCGCGGCGGTGTCCTCATTCGGCATCAGCGGC
ACCAACGCCCACCTCATCCTCCAACAACCCCCCACCCCCGACACCACACAAACCCCCAAC
ACCACAACAGGTTCTGATCCCGCAGTGGGTTCTGATCCCGCAGTGGGTGTACTGGTGTGG
CCGTTGTCAGCGCGTTCAGCGCCGGGGTTAAGCGCACAAGCGGCCCGTCTGTACCAGCAT
CTCAGCGCCCACCCCGATCTGGATCCGATCGATGTAGCCCACAGCCTGGCTACCACACGC
AGCCACCACCCCCACCGCGCCACCATCACCACCAGCATTGAGCACCACAGCGAAAACAAC
CACGACACAACCGATGCGCTGGCCGCACTGCACGCCCTGGCCAACAACGGCACACACCCC
CTGCTGAGCAGAGGCCTGCTGACCCCACAGGGCCCCGGCAAAACAGTGTTCGTGTTCCCC
GGACAGGGCAGTCAATACCCCGGCATGGGCGCAGATCTCTACCGCCAATTCCCCGTGTTC
GCCCACGCCCTCGACGCATGCGACGCAGCGTTACAGCCTTTCACTGGATGGTCGGTGCTA
GCTGTGTTACACGACGAACCCGAGGCCCCGTCGTTGGAGCGGGTCGATGTGGTCCAGCCT
GTGTTGTTCTCGGTGATGGTGTCGTTAGCCGCACTCTGGCGGTGGGCCGGAATCACCCCC
GATGCAGTCATCGGCCACTCCCAGGGCGAGATCGCCGCGGCACATGTGGCCGGAGCCCTG
ACCTTGCCCGAAGCAGCTGCGGTAGTGGCTTTGCGCAGCCGTGTCTTGACCGACCTGGCC
GGTGCCGGTGCCATGGCTTCAGTGCTATCGCCCGAGGAACCACTGACCCAGCTGCTGGCA
CGGTGGGACGGCAAGATCACTGTCGCCGCAGTTAACGGCCCCGCTAGCGCTGTGGTCTCC
GGCGATACCACAGCGATCACCGAATTGCTGATTACCTGCGAACACGAAAACATCGACGCT
CGCGCTATCCCGGTGGACTACCCCTCTCATTCCCCCTATATGGAACACATCCGCCATCAG
TTCCTCGACGAGCTACCCGAGCTGACACCGCGGCCATCAACCATCGCGATGTATTCCACC
GTCGACGGCGAACCTCACGACACCGCCTACGACACCACCACAATGACCGCGGACTACTGG
TACCGCAACATCCGTAACACTGTCCGGTTCCATGACACTGTCGCTGCCCTGCTCGGGGCG
GGTGAGCAGGTTTTCCTGGAACTTTCACCTCACCCGGTGTTGACACAAGCGATCACCGAC
ACCGTCGAACAAGCCGGCGGCGGCGGCGCAGCAGTGCCAGCTCTACGCAAGGATCGCCCT
GATGCTGTCGCGTTCGCTGCAGCACTCGGCCAGCTGCACTGCCATGGCATCAGCCCATCC
TGGAATGTTCTTTACTGCCAGGCCCGCCCCCTCACACTGCCCACCTACGCTTTCCAGCAT
CAGCGTTACTGGCTGCTGCCCACCGCTGGTGATTTCAGCGGGGCCAATACCCACGCCATG
CATCCGCTGCTAGACACCGCCACCGAACTGGCCGAAAACCGCGGATGGGTGTTCACCGGC
CGGATCAGCCCACGCACCCAACCATGGCTAAACGAACACGCCGTCGAATCAGCCGTGCTG
TTCCCAGGCACCGGATTTGTCGAGCTAGCGCTGCATGTCGCTGACCGTGCCGGATATTCC
TCGGTCAACGAACTGATCGTGCACACCCCCCTGCTACTCGCTGGCCACGACACCGCGGAT
CTACAGATCACCGTCACCGACACCGATGACATGGGCCGGCAGTCTCTTAACATCCACTCG
CACCCACATATCGGCCATGACAACACCACCACCGGCGATGAACAACCCGAGTGGGTCCTG
CATGCCAGCGCAGTCCTGACCGCACAAACCACCGACCACAACCACCTCCCCCTAACGCCT
GTGCCGTGGCCTCCACCCGGCACAGCCGCGATCGAGGTGGATGACTTCTACGACGACCTG
GCTGCACAGGGCTACAACTACGGCCCGACATTCCAAGGTGTGCAACGGATATGGCGTGAC
CACGCCACACCCGATGTCATCTACGCCGAAGTTGAACTACCCGAAGACACCGACATCGAC
GGCTACGGCATCCACCCCGCCCTATTCGACGCCGCTTTACACCCCCTACTCGCCCTGACC
CAACCCCCCACCAACGACACCGATGACACCAACACCGCAGACACCGGTGACCAGGTGCGG
CTGCCCTACGCCTTTACCGGCATCAGTTTGCACGCCACCCACGCCACCCGATTGCGGGTA
CGGCTGACCCGTACCGGCGCCGATGCCATCACCGTGCACACCAGTGACACCACCGGAGCC
CCGGTGGCGATCATCGACTCATTGATCACCCGCCCCCTCACCACCGCCACAGGGTCTGCT
CCGGCAACCACAGCAGCTGGCCTACTACACCTGAGCTGGCCACCACACCCTGACACCACG
ACCGACACCGACACCGACACCGATGCCCTGCGGTATCAGGTGATCGCCGAACCCACTCAA
CAACTGCCCCGCTACCTGCACGACCTACACACCAGCACCGACCTGCACACCAGCACCACC
GAAGCAGACGTGGTTGTGTGGCCGGTACCGGTGCCCAGCAACGAAGAGCTCCAGGCACAC
CAAGCATCCGACACCGCGGTGTCTTCTCGGATACACACCCTGACCCGCCAAACACTTACC
GTGGTGCAGGACTGGCTCACTCACCCCGACACCACCGGCACCCGACTGGTCATCGTGACC
CGCCACGGCGTCAGCACCAGTGCCCACGACCCGGTCCCCGACCTAGCCCACGCCGCAGTG
TGGGGCCTGATCCGCAGCGCCCAAAACGAACACCCCGGACGCTTCACACTGCTCGACACC
GACGACAACACCAACAGCGACACCCTCACCACCGCCCTAACCCTGCCAACCCGCGAAAAC
CAACTGGCCATACGCCGCGACACCATCCACATCCCCCGCCTGACCCGCACCGCTGTCCTG
ACACCACCGGACAGCGGCCCCTGGCGCCTTGACACCACCGGCAAGGGTGATCTGGCCAAC
CTCGCCCTGCTACCGACCGCCCACACTGCCCTGGCCTCTGGACAAATCCGTATCGATGTC
CGGGCCGCTGGTTTGAATTTTCACGACGTGGTCGTCGCGTTGGGGCTAATCCCCGACGAC
GGATTCGGCGGAGAAGCCGCCGGGGTGATCAGCGAGATCGGTCCCGACGTCTACGGATTC
GCCGTGGGTGATGCCGTGACCGGCATGACCGTCTCTGGTGCGTTTGCCCCCAGCACTGTC
GCTGATCACCGCATGGTGATGACGATCCCGGCCCGGTGGTCCTTCCCCCAAGCCGCATCC
ATACCGGTGGTATTCCTGACCGCCTACATCGCTTTGGCCGAGATCTCGGGCCTAAGCCGA
GGGCAACGAGTGCTGATCCATGCCGGCACTGGCGGTGTGGGTATGGCTGCGATTCAATTG
GCACACCATTTGGGTGCCGAAGTATTCGCCACCGCCAGCGCCGCGAAATGGAGCACCCTT
GAGGCACTGGGGGTACCGCGCGACCATATCGCTTCCTCGCGTACTCTGGACTTTTCCAAC
GCATTCCTCGATGCCACCAACGGCGCCGGTGTTGATGTCGTATTGAACTGCCTCAGTGGT
GAATTCGTCGAAGCATCCCTAGCCCTGCTGCCCCGCGGTGGCCATTTCGTCGAAATCGGC
AAAACCGACATCCGTGATACCGAGGTCATCGCCGCAACCCATCCCGGCGTCATTTACCGC
GCCCTCGATCTGCTCAGCGTCTCCCCCGATCACATCCAGCGCACACTGGCCCAACTGTCC
CCACTGTTTGCCACCGACACCCTAAAACCCCTACCGACCACTAATTACAGCATCTACCAA
GCCATCTCGGCCTTACGTGACATGAGTCAAGCCCGTCACACAGGCAAGATCGTGCTCACT
GCGCCGGTGGTGGTAGATCCTGAGGGCACGGTGTTGATCACCGGGGGGACCGGGACGCTG
GGTGCCTTGTTCGCCGAGCATCTGGTTTCTGCCCATGGTGTCCGGCATCTGTTGTTGACC
TCGCGGCGCGGACCTCAGGCCCACGGTGCCACCGATCTGCAGCAGCGGCTCACCGATCTA
GGTGCTCATGTCACCATCACGGCCTGCGATATCAGCGACCCCGAAGCACTGGCCGCCCTG
GTCAATTCAGTGCCCACACAACACCGTTTAACCGCGGTAGTGCACACCGCCGCGGTATTG
GCCGACACCCCGGTCACCGAGTTGACCGGCGATCAACTCGACCAGGTGCTGGCCCCCAAA
ATCGACGCGGCATGGCAGCTGCACCAACTCACCTACGAACACAACCTGTCTGCATTCATC
ATGTTCTCGTCCATGGCCGGAATGATAGGCAGTCCCGGTCAGGGTAACTACGCGGCAGCC
AACACCGCGTTAGATGCTCTCGCCGACTACCGCCACCGCCTGGGCTTGCCCGCGACCAGC
CTGGCCTGGGGCTACTGGCAGACTCACACCGGTCTCACCGCGCATCTAACCGATGTAGAT
CTAGCCCGCATGACCCGCCTGGGTTTGATGCCCATCGCCACCAGCCACGGACTGGCCCTG
TTCGATGCCGCCCTCGCCACCGGACAGCCCGTTTCGATACCCGCCCCGATCAACACCCAC
ACCCTGGCCCGACACGCCCGCGACAACACCCTGGCCCCGATCCTGTCTGCGCTGATCACC
ACACCACGGCGCCGGGCGGCCTCTGCCGCAACCGATCTCGCTGCCCGCCTCAACGGACTT
AGCCCCCAACAGCAACAACAAACACTGGCCACCCTCGTGGCCGCGGCCACCGCCACCGTG
CTGGGCCACCACACCCCCGAAAGCATCAGCCCAGCCACCGCGTTCAAAGACCTCGGAATC
GATTCGCTGACCGCCCTTGAACTGCGCAACACCCTCACCCACAACACCGGCCTCAACCTT
TCGTCCACTCTTATCTTCGATCACCCCACACCCCATGCGGTGGCCGAGCATCTGCTTGAA
CAGATCCCTGGCATCGGTGCCCTGGTGCCGGCTCCGGTGGTGATCGCAGCTGGTCGTACC
GAGGAGCCGGTGGCGGTGGTGGGGATGGCGTGTCGTTTCCCCGGTGGTGTCGCATCAGCG
GATCAGTTGTGGGACTTGGTGATCGCTGGCCGTGATGTGGTGGGTAATTTTCCGGCCGAT
CGGGGTTGGGATGTGGAGGGACTGTTTGATCCCGATCCGGACGCGGTCGGCAAAACCTAC
ACCCGTTACGGCGCGTTCCTTGACGATGCGGCAGGTTTTGATGCCGGGTTCTTTGGGATC
TCTCCACGGGAGGCACGCGCGATGGACCCCCAGCAGCGGCTGCTGCTGGAGGTGTGCTGG
GAAGCGCTAGAAACCGCGGGTATTCCCGCGCACACCTTGGCCGGCACCTCCACCGGGGTA
TTCGTCGGAGCCGGGGCCCAGTCCTACGGCGCCACCAACTCCGATGACGCTGAGGGGTAT
GCGATGACCGGCGGCGCGACTAGCGTCATGTCCGGCCGTATCGCCTACACCTTGGGCCTA
GAAGGTCCAGCGATCACCGTTGACACCGCCTGCTCGTCATCGCTGGTGGCAATTCACCTG
GCCTGCCAATCCTTACGCAACAACGAATCCCAGCTAGCACTGGCCGGCGGCGTCACCGTG
ATGAGCACACCTGCGGTTTTCACCGAGTTCTCCCGCCAACGCGGCCTGGCCCCAGATGGA
CGCTGCAAAGCCTTCGCCGCTACCGCCGATGGCACCGGCTTTGGTGAAGGCGCCGCGGTC
TTGGTCCTTGAACGGCTCTCCGAGGCCCGCCGCAACAACCACCCGGTCCTTGCGATCGTC
GCTGGATCGGCGATCAACCAAGACGGCGCATCCAACGGACTGACCGCACCCCACGGCCCG
TCACAACAACGCGTCATCAACCAAGCACTAGCCAACGCCGGCCTCACCCACGACCAGGTC
GACGCCGTCGAAGCCCACGGCACCGGCACCACACTGGGTGACCCCATCGAAGCCGGCGCC
CTACACGCCACCTACGGCCACCACCACACGCCCGATCAACCGCTTTGGCTGGGATCCATC
AAATCCAACATCGGCCACACCCAAGCCGCCGCCGGCGCCGCCGGTGTGGTCAAGATGATC
CAAGCCATCACCCACGCCACCTTGCCCGCCACCTTGCACGTCGACCAACCCAGCCCCCAC
ATCGACTGGTCCAGCGGCACAGTCCGACTCCTAACCGAGCCCATCCAATGGCCCAACACC
GACCACCCCCGCACCGCGGCGGTGTCCTCATTCGGCATCAGCGGCACCAACGCCCACCTC
ATCCTCCAACAACCCCCCACCCCTAACCCCACACAAACCCCCGAGGACTGCAGCCCCGCA
CAATCTCCCTGCGCAACAATCACCGATGCAGGCACGGGATTATCGTTTGTGCCCTGGGTG
ATTTCAGCGAAGTCGGCTGAGGCGTTGTCTGCGCAGGCGAGCCGATTGTTGACGCGCCTT
GACGATGATCCAGTTGTCGATGCAATCGACCTGGGGTGGTCATTGATAGCCACTCGATCG
ATGTTTGAGCATCGCGCAGTAGTTGTGGGTGCGGATCGTCACCAGTTGCAGCGCGGGTTG
GCCGAGTTGGCTTCTGGTAACTTGGGCGCCGATGTAGTGGTGGGCCGGGCCCGCGCAGCG
GGCGAGACTGTAATGGTGTTTCCCGGTCAGGGATCACAGCGGTTGGGCATGGGCGCGCAG
CTTTATGAACAATTCCCGGTATTCGCGGCGGCGTTTGATGACGTTGTTGATGCGCTGGAC
CAGTATCTGCGGTTGCCGCTACGCCAAGTTATGTGGGGTGACGATGAAGGCCTGCTCAAT
TCAACGGAGTTCGCCCAGCCGTCGTTGTTTGCTGTCGAGGTCGCACTGTTTGCGTTGCTG
CGCTTCTGGGGTGTCGTTCCGGATTACGTGATAGGCCATTCGGTAGGAGAGCTGGCCGCT
GCACAAGTGGCTGGCGTTTTGAGCCTGCAGGACGCGGCTAAATTAGTTTCAGCGCGGGGC
CGACTGATGCAGGCCCTGCCCGCCGGTGGAGCGATGGTCGCGGTAGCCGCCAGCCAGCAT
GAAGTCGAGCCTTTGCTGGTTGAAGGGGTCGATATCGCGGCGCTCAATGCGCCAGGGTCA
GTTGTGATCTCTGGTGATCAGGCGGCAGTCCGTTTGATCGCTAATCGATTGGCGGATAGG
GGCTACAGGGCGCACGAACTTGCGGTTTCGCATGCCTTTCATTCATCGTTGATGGAGCCG
ATGTTGGAGGAGTTCGCTCGGCTCGCTTCTGAAATCGTTGTGGAGCAACCGCAGATTCCA
CTGATTTCGAACGTGACTGGTCAGCTGGCCAACGCCGACTACGGGTCGGCAGGTTACTGG
GTGGACCACATCCGCCGTCCAGTCCGTTTCGCCGATAGTGTCGCTTCGTTGGAAGCCATG
GGGGCTAGCTGCTTCATTGAAGTCGGTCCAGCCAGCGGGTTGGGCGCAGCTATCGAGCAA
TCCTTGAAATCTGCCGAGCCGACCGTGTCAGTGTCGGCACTGTCCACCGATAAACCTGAA
TCCGTCGCCGTATTGCGCGCTGCAGCACGACTTTCCACCTCCGGCATTCCTGTGGATTGG
CAGTCGGTGTTCGACGGCCGCAGCACCCAGACAGTTAACCTGCCCACCTACGCCTTCCAG
CGGCAACGGTTCTGGCTCGACGCCAACCGTATCGGTCAAGGCGATCCCGCCAGTCAACCA
CAGGCCCAGAACGTTGAATCCCGTTTTTGGGAGGCGGTCGAGCGGGAAGACGTTGATGGC
TTGGCTGATTCTATAGGTGTCACCGCCAGTGCCATGCAGACCGTGCTACCTGCATTGTCT
TCATGGCGTCGCGCGGAGCGCACACAGTCCGAGCTTGATTCCTGGCGCTATCAGGTGACA
TGGCTGTCTTCCCCAGCAACGCCGAGTTCGATCACGCTGTCCGGCATTTGGTTGCTGATA
GTTCCAAGCGAACTTGCAAAGACTGACCCAGTAATTGGATGTGCTGCAGCGCTCGAAGCG
CACGGCGCCTTAGTCACGATTATCACAATTTTCGAGCCGGACTTCAATCGCTCATTGATG
GGCGCTTCCCTAAAAGATATCGGTTCACACATATCTGGTGTCATATCGTTCTTAGGGATT
CACGGGTCCGAATTCTCCGATAGCGGCGCGGTCAAGACATTAAATCTTGTGCAAGCAATG
GGCGATGTCCACTTAGACGTTCCTTTGTGGTGCCTAACGCAGGGCGCGGTATCGATCAGC
GCCGACGATTTGATCCGATGCTCGTCAGCAGCCCTGGTGTGGGGTCTGGGGAGAGTCGTC
GCATTAGAGCACCCGGGATCGTGGGGTGGCTTAGTAGACCTCCCCGAGTCACCCGACGAT
GCAGCATGGGAGCGCTTGTGCGCCCTCCTCGCGCAGCCGACGGATGAAGATCAGTTTGCG
ATCAGGCCGTCTGGGGTTTTCCTACGGAGATTGATCCACGCCCCGGCAACCACGACATCC
AAATCCTCGACCGCGTGGGCTCCGAGGGGGACCGTGTTAATCACAGGCGGCACAGGCGCG
TTAGGCGCACACGTCGCAAGGTGGTTGGCCCACAAATATGAATCGGTAGATTTGCTCTTA
ACCAGCCGTCGCGGGATGGCAGCCGATGGAGCTACAGAGCTAGTGGATGACCTCCGCACG
GCTGGCGCCAGTGTGACAGTGCACGCCTGCGACGTGACAGACCGCACTTCAGTCGAGGCT
GCAATAGCAGGTAAATCCCTTGATGCGGTCTTTCATCTTGCAGGACGACACCAGCCAACT
CTGCTAACAGAACTCGAGGACGAATCCTTTAGTGACGAATTGGCGCCGAAGGTTCACGGT
GCCCAAGTATTGAGTGACATCACGTCTAACCTCACACTATCAGCGTTTGTCATGTTCTCG
TCAGTAGCCGGAATCTGGGGCGGCAAAAGTCAAGGCGCATATGCTGCCGCTAACGCATTC
TTAGATTCGCTCGCCGAGAAACGGCGCACGTTGGGGTTACCAGCAACATCGGTCGCTTGG
GGACTGTGGGCTGGCGGCGGCATGGGAGACCGGCCATCCGCTTCGGGACTAAACCTTATT
GGCTTGAAATCGATGTCAGCAGATTTAGCTGTGCAGGCGCTAAGCGACGCCATTGACAGA
CCGCAAGCAACATTGACTGTTGCGAGCGTCAACTGGGATCGGTTCTACCCCACATTCGCT
TTGGCGCGACCGAGGCCCTTCCTACACGAAATCACAGAGGTAATGGCTTACCGCGAGTCG
ATGCGCTCAAGCTCTGCATCGACGGCGACGCTCCTGACGAGCAAATTAGCCGGACTAACG
GCGACAGAACAGCGTGCAGTCACCCGGAAGTTGGTCCTTGATCAAGCCGCATCCGTTCTC
GGGTACGCCTCAACTGAGAGTCTCGATACTCATGAGTCATTCAAAGACCTCGGATTTGAT
TCGCTGACCGCCCTTGAACTGCGCGACCACCTCCAAACTGCGACCGGCCTCAACCTTTCG
TCCACTCTTATCTTCGATCACCCCACACCCCATGCGGTGGCCGAGCATCTGCTTGAACAG
ATCCCTGGCATCGGTGCCCTGGTGCCGGCTCCGGTGGTGATCGCAGCTGGTCGTACCGAG
GAGCCGGTGGCGGTGGTGGGGATGGCGTGTCGTTTCCCCGGTGGTGTCGCATCAGCGGAT
CAGTTGTGGGACTTGGTGATCGCTGGCCGTGATGTGGTGGGTAATTTTCCGGCCGATCGG
GGTTGGGATGTGGAGGGACTGTTTGATCCCGATCCGGACGCGGTCGGCAAAACCTACACC
CGTTACGGCGCGTTCCTTGACGATGCGGCAGGTTTTGATGCCGGGTTCTTTGGGATCTCT
CCACGGGAGGCACGCGCGATGGACCCCCAGCAGCGGCTGCTGCTGGAGGTGTGCTGGGAA
GCGCTAGAAACCGCGGGTATTCCCGCGCACACCTTGGCCGGCACCTCCACCGGGGTATTC
GCCGGAGCCTGGGCCCAGTCCTACGGCGCCACCAACTCCGATGACGCTGAGGGGTATGCG
ATGACCGGCGGCTCGACTAGCGTCATGTCCGGCCGTATCGCCTACACCTTGGGCCTAGAA
GGTCCAGCGATCACCGTTGACACCGCCTGCTCGTCATCGCTGGTGGCAATTCACCTGGCC
TGCCAATCCTTACGCAACAACGAATCCCAGCTAGCACTGGCCGGCGGCGTCACCGTGATG
AGCACACCTGCGATTTTCACCGAGTTCTCCCGCCAACGCGGCCTGGCCCCAGATGGACGC
TGCAAAGCCTTCGCCGCTACCGCCGATGGCACCGGCTTTGGTGAAGGCGCCGCGGTCTTG
GTCCTTGAACGGCTCTCCGAGGCCCGCCGCAACAACCACCCGGTCCTTGCGATCGTCGCT
GGATCGGCGATCAACCAAGACGGCGCATCCAACGGACTGACCGCACCCCACGGCCCGTCA
CAACAACGCGTCATCAACCAAGCACTAGCCAACGCCGGCCTCACCCACGACCAGGTCGAC
GCCGTCGAAGCCCACGGCACCGGCACCACACTGGGTGACCCCATCGAAGCCAGCGCCCTA
CACGCCACCTACGGCCACCACCACACGCCCGATCAACCGCTTTGGCTGGGATCCATCAAA
TCCAACATCGGCCACACCCAAGCCGCCGCCGGCGCCGCCGGTGTGGTCAAGATGATCCAA
GCCATCACCCACGCCACCTTGCCCGCCACCTTGCACGTCGACCAACCCAGCCCCCACATC
GACTGGTCCAGCGGCACAGTCCGACTCCTAACCGAGCCCATCCAATGGCCCAACACCGAC
CACCCCCGCACCGCGGCGGTGTCCTCATTCGGCATCAGCGGCACCAACGCCCACCTCATC
CTCCAACAACCCCCCACCCCCGACACCACACAAACCCCCAACACCACAACAGGTTCTGAT
CCCGCAGTGGGTTCTGATCCCGCAGTGGGTGTACTGGTGTGGCCGTTGTCAGCGCGTTCA
GCGCCGGGGTTAAGCGCACAAGCGGCCCGTCTGTACCAGCATCTCAGCGCCCACCCCGAT
CTGGATCCGATCGATGTAGCCCACAGCCTGGCTACCACACGCAGCCACCACCCCCACCGC
GCCACCATCACCACCAGCATTGAGCACCACAGCGAAAACAACCACGACACAACCGATGCG
CTGGCCGCACTGCACGCCCTGGCCAACAACGGCACACACCCCCTGCTGAGCAGAGGCCTG
CTGACCCCACAGGGCCCCGGCAAAACAGTGTTCGTGTTCCCCGGACAGGGCAGTCAATAC
CCCGGCATGGGCGCAGATCTCTACCGCCAATTCCCCGTGTTCGCCCACGCCCTCGACGCA
TGCGACGCAGCGTTACAGCCTTTCACTGGATGGTCGGTGCTAGCTGTGTTACACGACGAA
CCCGAGGCCCCGTCGTTGGAGCGGGTCGATGTGGTCCAGCCTGTGTTGTTCTCGGTGATG
GTGTCGTTAGCCGCACTCTGGCGGTGGGCCGGAATCACCCCCGATGCAGTCATCGGCCAC
TCCCAGGGCGAGATCGCCGCGGCACATGTGGCCGGAGCCCTGACCTTGCCCGAAGCAGCT
GCGGTAGTGGCTTTGCGCAGCCGTGTCTTGACCGACCTGGCCGGTGCCGGTGCCATGGCT
TCAGTGCTATCGCCCGAGGAACCACTGACCCAGCTGCTGGCACGGTGGGACGGCAAGATC
ACTGTCGCCGCAGTTAACGGCCCCGCTAGCGCTGTGGTCTCCGGCGATACCACAGCGATC
ACCGAATTGCTGATTACCTGCGAACACGAAAACATCGACGCTCGCGCTATCCCGGTGGAC
TACCCCTCTCATTCCCCCTATATGGAACACATCCGCCATCAGTTCCTCGACGAGCTACCC
GAGCTGACACCGCGGCCATCAACCATCGCGATGTATTCCACCGTCGACGGCGAACCTCAC
GACACCGCCTACGACACCACCACAATGACCGCGGACTACTGGTACCGCAACATCCGTAAC
ACTGTCCGGTTCCATGACACTGTCGCTGCCCTGCTCGGGGCGGGTGAGCAGGTTTTCCTG
GAACTTTCACCTCACCCGGTGTTGACACAAGCGATCACCGACACCGTCGAACAAGCCGGC
GGCGGCGGCGCAGCAGTGCCAGCTCTACGCAAGGATCGCCCTGATGCTGTCGCGTTCGCT
GCAGCACTCGGCCAGCTGCACTGCCATGGCATCAGCCCATCCTGGAATGTTCTTTACTGC
CAGGCCCGCCCCCTCACACTGCCCACCTACGCTTTCCAGCATCAGCGTTACTGGCTGCTG
CCCACCGCTGGTGATTTCAGCGGGGCCAATACCCACGCCATGCATCCGCTGCTAGACACC
GCCACCGAACTGGCCGAAAACCGCGGATGGGTGTTCACCGGCCGGATCAGCCCACGCACC
CAACCATGGCTAAACGAACACGCCGTCGAATCAGCCGTGCTGTTCCCAGGCACCGGATTT
GTCGAGCTAGCGCTGCATGTCGCTGACCGTGCCGGATATTCCTCGGTCAACGAACTGATC
GTGCACACCCCCCTGCTACTCGCTGGCCACGACACCGCGGATCTACAGATCACCGTCACC
GACACCGATGACATGGGCCGGCAGTCTCTTAACATCCACTCGCACCCACATATCGGCCAT
GACAACACCACCACCGGCGATGAACAACCCGAGTGGGTCCTGCATGCCAGCGCAGTCCTG
ACCGCACAAACCACCGACCACAACCACCTCCCCCTAACGCCTGTGCCGTGGCCTCCACCC
GGCACAGCCGCGATCGAGGTGGATGACTTCTACGACGACCTGGCTGCACAGGGCTACAAC
TACGGCCCGACATTCCAAGGTGTGCAACGGATATGGCGTGACCACGCCACACCCGATGTC
ATCTACGCCGAAGTTGAACTACCCGAAGACACCGACATCGACGGCTACGGCATCCACCCC
GCCCTATTCGACGCCGCTTTACACCCCCTACTCGCCCTGACCCAACCCCCCACCAACGAC
ACCGATGACACCAACACCGCAGACACCGGGGACCAGGTGCGGCTGCCCTACGCCTTTACC
GGCATCAGTTTGCACGCCACCCACGCCACCCGATTACGGGTACGGCTGACCCGTACCGGC
GCCGATGCCATCACCGTGCACACCAGTGACACCACCGGAGCCCCGGTGGCGATCATCGAC
TCATTGATCACCCGCCCCCTCACCACCGCCACAGGGTCTGCTCCGGCAACCACAGCAGCT
GGCCTACTACACCTGAGCTGGCCACCACACCCTGACACCACGACCGACACCGACACCGAC
ACCGATGCCCTGCGGTATCAGGTGATCGCCGAACCCACTCAACAACTGCCCCGCTACCTG
CACGACCTACACACCAGCACCACCGAAGCAGACGTGGTTGTGTGGCCGGTACCGGTGCCC
AGCAACGAAGAGCTCCAGGCACACCAAGCATCCGACACCGCGGTGTCTTCTCGGATACAC
ACCCTGACCCGCCAAACACTTACCGTGGTGCAGGACTGGCTCACTCACCCCGACACCACC
GGCACCCGACTGGTCATCGTGACCCGCCACGGCGTCAGCACCAGTGCCCACGACCCGGTC
CCCGACCTAGCCCACGCCGCAGTGTGGGGCCTGATCCGCAGCGCCCAAAACGAACACCCC
GGACGCTTCACACTGCTCGACACCGACGACAACACCAACAGCGACACCCTCACCACCGCC
CTAACCCTGCCAACCCGCGAAAACCAACTGGCCATACGCCGCGACACCATCCACATCCCC
CGCCTGACCCGACACAGCAGTGACGGTGCGCTCACTGCGCCGGTGGTGGTAGATCCTGAG
GGCACGGTGTTGATCACCGGGGGGACCGGGACGCTGGGTGCCTTGTTCGCCGAGCATCTG
GTTTCTGCCCATGGTGTCCGGCATCTGTTGTTGACCTCGCGGCGCGGACCTCAGGCCCAC
GGTGCCACCGATCTGCAGCAGCGGCTCACCGATCTAGGTGCTCATGTCACCATCACGGCC
TGCGATATCAGCGACCCCGAAGCACTGGCCGCCCTGGTCAATTCAGTGCCCACACAACAC
CGTTTAACCGCGGTAGTGCACACCGCCGCGGTATTGGCCGACACCCCGGTCACCGAGTTG
ACCGGCGATCAACTCGACCAGGTGCTGGCCCCCAAAATCGACGCGGCATGGCAGCTGCAC
CAACTCACCTACGAACACAACCTGTCTGCATTCATCATGTTCTCGTCCATGGCCGGAATG
ATAGGCAGTCCCGGTCAGGGTAACTACGCGGCAGCCAACACCGCGTTAGATGCTCTCGCC
GACTACCGCCACCGCCTGGGCTTGCCCGCGACCAGCCTGGCCTGGGGCTACTGGCAGACT
CACACCGGTCTCACCGCGCATCTAACCGATGTAGATCTAGCCCGCATGACCCGCCTGGGT
TTGATGCCCATCGCCACCAGCCACGGACTGGCCCTGTTCGATGCCGCCCTCGCCACCGGA
CAGCCCGTTTCGATACCCGCCCCGATCAACACCCACACCCTGGCCCGACACGCCCGCGAC
AACACCCTGGCCCCGATCCTGTCTGCGCTGATCACCACACCACGGCGCCGGGCGGCCTCT
GCCGCAACCGATCTCGCTGCCCGCCTCAACGGACTTAGCCCCCAACAGCAACAACAAACA
CTGGCCACCCTCGTGGCCGCGGCCACCGCCACCGTGCTGGGCCACCACACCCCCGAAAGC
ATCAGCCCAGCCACCGCGTTCAAAGACCTCGGAATCGATTCGCTGACCGCCCTTGAACTG
CGCAACACCCTCACCCACAACACCGGCCTGGATCTGCCCCCCACCCTCATCTTCGATCAC
CCCACACCCCATGCGGTGGCCGAGCATCTGCTTGAACAGATCCCTGGCATCGGTGCCCTG
GTGCCGGCTCCGGTGGTGATCGCAGCTGGTCGTACCGAGGAGCCGGTGGCGGTGGTGGGG
ATGGCGTGTCGTTTCCCCGGTGGTGTCGCATCAGCGGATCAGTTGTGGGACTTGGTGATC
GCTGGCCGTGATGTGGTGGGTAATTTTCCGGCCGATCGGGGTTGGGATGTGGAGGGACTG
TTTGATCCCGATCCGGACGCGGTCGGCAAAACCTACACCCGTTACGGCGCGTTCCTTGAC
GATGCGGCAGGTTTTGATGCCGGGTTCTTTGGGATCTCTCCACGGGAGGCACGCGCGATG
GACCCCCAGCAGCGGCTGCTGCTGGAGGTGTGCTGGGAAGCGCTAGAAACCGCGGGTATT
CCCGCGCACACCTTGGCCGGCACCTCCACCGGGGTATTCGCCGGAGCCTGGGCCCAGTCC
TACGGCGCCACCAACTCCGATGACGCTGAGGGGTATGCGATGACCGGCGGCTCGACTAGC
GTCATGTCCGGCCGTATCGCCTACACCTTGGGCCTAGAAGGTCCAGCGATCACCGTTGAC
ACCGCCTGCTCGTCATCGCTGGTGGCAATTCACCTGGCCTGCCAATCCTTACGCAACAAC
GAATCCCAGCTAGCACTGGCCGGCGGCGTCACCGTGATGAGCACACCTGCGGTTTTCACC
GAGTTCTCCCGCCAACGCGGCCTGGCCCCAGATGGACGCTGCAAAGCCTTCGCCGCTACC
GCCGATGGCACCGGCTTTGGTGAAGGCGCCGCGGTCTTGGTCCTTGAACGGCTCTCCGAG
GCCCGCCGCAACAACCACCCGGTCCTTGCGATCGTCGCTGGATCGGCGATCAACCAAGAC
GGCGCATCCAACGGACTGACCGCACCCCACGGCCCGTCACAACAACGCGTCATCAACCAA
GCACTAGCCAACGCCGGCCTCACCCACGACCAGGTCGACGCCGTCGAAGCCCACGGCACC
GGCACCACACTGGGTGACCCCATCGAAGCCAGCGCCCTACACGCCACCTACGGCCACCAC
CACACGCCCGATCAACCGCTTTGGCTGGGATCCATCAAATCCAACATCGGCCACACCCAA
GCCGCCGCCGGCGCCGCCGGTGTGGTCAAGATGATCCAAGCCATCACCCACGCCACCTTG
CCCGCCACCTTGCACGTCGACCAACCCAGCCCCCACATCGACTGGTCCAGCGGCACAGTC
CGACTCCTAACCGAGCCCATCCAATGGCCCAACACCGACCACCCCCGCACCGCGGCGGTG
TCCTCATTCGGCATCAGCGGCACCAACGCCCACCTCATCCTCCAACAACCCCCCACCCCC
GACACCACACAAACCCCCAACACCACAACAGGTTCTGATCCCGCAGTGGGTTCTGATCCC
GCAGTGGGTGTACTGGTGTGGCCGTTGTCAGCGCGTTCAGCGCCGGGGTTAAGCGCACAA
GCGGCCCGTCTGTACCAGCATCTCAGCGCCCACCCCGATCTGGATCCGATCGATGTAGCC
CACAGCCTGGCTACCACACGCAGCCACCACCCCCACCGCGCCACCATCACCACCAGCATT
GAGCACCACAGCGAAAACAACCACGACACAACCGATGCGCTGGCCGCACTGCACGCCCTG
GCCAACAACGGCACACACCCCCTGCTGAGCAGAGGCCTGCTGACCCCACAGGGCCCCGGC
AAAACAGTGTTCGTGTTCCCCGGACAGGGCAGTCAATACCCCGGCATGGGCGCAGATCTC
TACCGCCAATTCCCCGTGTTCGCCCACGCCCTCGACGCATGCGACGCAGCGTTACAGCCT
TTCACTGGATGGTCGGTGCTAGCTGTGTTACACGACGAACCCGAGGCCCCGTCGTTGGAG
CGGGTCGATGTGGTCCAGCCTGTGTTGTTCTCGGTGATGGTGTCGTTAGCCGCACTCTGG
CGGTGGGCCGGAATCACCCCCGATGCAGTCATCGGCCACTCCCAGGGCGAGATCGCCGCG
GCACATGTGGCCGGAGCCCTGACCTTGCCCGAAGCAGCTGCGGTAGTGGCTTTGCGCAGC
CGTGTCTTGACCGACCTGGCCGGTGCCGGTGCCATGGCTTCAGTGCTATCGCCCGAGGAA
CCACTGACCCAGCTGCTGGCACGGTGGGACGGCAAGATCACTGTCGCCGCAGTTAACGGC
CCCGCTAGCGCTGTGGTCTCCGGCGATACCACAGCGATCACCGAATTGCTGATTACCTGC
GAACACGAAAACATCGACGCTCGCGCTATCCCGGTGGACTACCCCTCTCATTCCCCCTAT
ATGGAACACATCCGCCATCAGTTCCTCGACGAGCTACCCGAGCTGACACCGCGGCCATCA
ACCATCGCGATGTATTCCACCGTCGACGGCGAACCTCACGACACCGCCTACGACACCACC
ACAATGACCGCGGACTACTGGTACCGCAACATCCGTAACACTGTCCGGTTCCATGACACT
GTCGCTGCCCTGCTCGGGGCGGGTGAGCAGGTTTTCCTGGAACTTTCACCTCACCCGGTG
TTGACACAAGCGATCACCGACACCGTCGAACAAGCCGGCGGCGGCGGCGCAGCAGTGCCA
GCTCTACGCAAGGATCGCCCTGATGCTGTCGCGTTCGCTGCAGCACTCGGCCAGCTGCAC
TGCCATGGCATCAGCCCATCCTGGAATGTTCTTTACTGCCAGGCCCGCCCCCTCACACTG
CCCACCTACGCTTTCCAGCATCAGCGTTACTGGCTGCTGCCCACCGCTGGTGATTTCAGC
GGGGCCAATACCCACGCCATGCATCCGCTGCTAGACACCGCCACCGAACTGGCCGAAAAC
CGCGGATGGGTGTTCACCGGCCGGATCAGCCCACGCACCCAACCATGGCTAAACGAACAC
GCCGTCGAATCAGCCGTGCTGTTCCCAGGCACCGGATTTGTCGAGCTAGCGCTGCATGTC
GCTGACCGTGCCGGATATTCCTCGGTCAACGAACTGATCGTGCACACCCCCCTGCTGCTC
GCTGGCCACGACACCGCGGATCTACAGATCACCGTCACCGACACCGATGACATGGGCCGG
CAGTCTCTTAACATCCACTCGCGCCCACATATCGGCCATGACAACACCACCACCGGCGAT
GAACAACCCGAGTGGGTCCTGCATGCCAGCGCAGTCCTGACCGCACAAACCACCGACCAC
AACCACCTCCCCCTAACGCCTGTGCCGTGGCCTCCACCCGGCACAGCCGCGATCGAGGTG
GATGACTTCTACGACGACCTGGCTGCACAGGGCTACAACTACGGCCCGACATTCCAAGGT
GTGCAACGGATATGGCGTGACCACGCCACACCCGATGTCATCTACGCCGAAGTTGAACTA
CCCGAAGACACCGACATCGACGGCTACGGCATCCACCCCGCCCTATTCGACGCCGCTTTA
CACCCCCTACTCGCCCTGACCCAACCCCCCACCAACGACACCGATGACACCAACACCGCA
GACACCGGTGACCAGGTGCGGCTGCCCTACGCCTTTACCGGCATCAGTTTGCACGCCACC
CACGCCACCCGATTACGGGTACGGCTGACCCGTACCGGCGCCGATGCCATCACCGTGCAC
ACCAGTGACACCACCGGAGCCCCGGTGGCGATCATCGACTCATTGATCACCCGCCCCCTC
ACCACCGCCACAGGGTCTGCTCCGGCAACCACAGCAGCTGGCCTACTACACCTGAGCTGG
CCACCACACCCTGACACCACGACCGACACCGACACCGACACCGATGCCCTGCGGTATCAG
GTGATCGCCGAACCCACTCAACAACTGCCCCGCTACCTGCACGACCTACACACCAGCACC
GACCTGCACACCAGCACCACCGAAGCAGACGTGGTTGTGTGGCCGGTACCGGTGCCCAGC
AACGAAGAGCTCCAGGCACACCAAGCATCCGACACCGCGGTGTCTTCTCGGATACACACC
CTGACCCGCCAAACACTTACCGTGGTGCAGGACTGGCTCACTCACCCCGACACCACCGGC
ACCCGACTGGTCATCGTGACCCGCCACGGCGTCAGCACCAGTGCCCACGACCCGGTCCCC
GACCTAGCCCACGCCGCAGTGTGGGGCCTGATCCGCAGCGCCCAAAACGAACACCCCGGA
CGCTTCACACTGCTCGACACCGACGACAACACCAACAGCGACACCCTCACCACCGCCCTA
ACCCTGCCAACCCGCGAAAACCAACTGGCCATACGCCGCGACACCATCCACATCCCCCGC
CTGACCCGCACCGCTGTCCTGACACCACCGGACAGCGGCCCCTGGCGCCTTGACACCACC
GGCAAGGGTGATCTGGCCAACCTCGCCCTGCTACCGACCGCCCACACTGCCCTGGCCTCT
GGACAAATCCGTATCGATGTCCGGGCCGCTGGTTTGAATTTTCACGACGTGGTCGTCGCG
TTGGGGCTAATCCCCGACGACGGATTCGGCGGAGAAGCCGCCGGGGTGATCAGCGAGATC
GGTCCCGACGTCTACGGATTCGCCGTGGGTGATGCCGTGACCGGCATGACCGTCTCTGGT
GCGTTTGCCCCCAGCACTGTCGCTGATCACCGCATGGTGATGACGATCCCGGCCCGGTGG
TCCTTCCCCCAAGCCGCATCCATACCGGTGGTATTCCTGACCGCCTACATCGCTTTGGCC
GAGATCTCGGGCCTAAGCCGAGGGCAACGAGTGCTGATCCATGCCGGCACTGGCGGTGTG
GGTATGGCTGCGATTCAATTGGCACACCATTTGGGTGCCGAAGTATTCGCCACCGCCAGC
GCCGCGAAATGGAGCACCCTTGAGGCACTGGGGGTACCGCGCGACCATATCGCTTCCTCG
CGTACTCTGGACTTTTCCAACGCATTCCTCGATGCCACCAACGGCGCCGGTGTTGATGTC
GTATTGAACTGCCTCAGTGGTGAATTCGTCGAAGCATCCCTAGCCCTGCTGCCCCGCGGT
GGCCATTTCGTCGAAATCGGCAAAACCGACATCCGTGATACCGAGGTCATCGCCGCAACC
CATCCCGGCGTCATTTACCGCGCCCTCGATCTGCTCAGCGTCTCCCCCGATCACATCCAG
CGCACACTGGCCCAACTGTCCCCACTGTTTGCCACCGACACCCTAAAACCCCTACCGACC
ACTAATTACAGCATCTACCAAGCCATCTCGGCCTTACGTGACATGAGTCAAGCCCGTCAC
ACAGGCAAGATCGTGCTCACTGCGCCGGTGGTGGTAGATCCTGAGGGCACGGTGTTGATC
ACCGGGGGGACCGGGACGCTGGGTGCCTTGTTCGCCGAGCATCTGGTTTCTGCCCATGGT
GTCCGGCATCTGTTGTTGACCTCGCGGCGCGGACCTCAGGCCCACGGTGCCACCGATCTG
CAGCAGCGGCTCACCGATCTAGGTGCTCATGTCACCATCACGGCCTGCGATATCAGCGAC
CCCGAAGCACTGGCCGCCCTGGTCAATTCAGTGCCCACACAACACCGTTTAACCGCGGTA
GTGCACACCGCCGCGGTATTGGCCGACACCCCGGTCACCGAGTTGACCGGCGATCAACTC
GACCAGGTGCTGGCCCCCAAAATCGACGCGGCATGGCAGCTGCACCAACTCACCTACGAA
CACAACCTGTCTGCATTCATCATGTTCTCGTCCATGGCCGGAATGATAGGCAGTCCCGGT
CAGGGTAACTACGCGGCAGCCAACACCGCGTTAGATGCTCTCGCCGACTACCGCCACCGC
CTGGGCTTGCCCGCGACCAGCCTGGCCTGGGGCTACTGGCAGACCCGCACCGGTGTCACC
GCGCATCTAACCGATGTAGATCTAGCCCGCATGACCCGCCTGGGTTTGATGCCCATCGCC
ACCAGCCACGGACTGGCCCTGTTCGATGCCGCCCTCGCCACCGGACAGCCCGTTTCGATA
CCCGCCCCGATCAACACCCACACCCTGGCCCGACACGCCCGCGACAACACCCTGACCCCG
ATCCTGTCTGCGCTGATCACCACACCACGGCGCCGGGCGGCCTCTGCCGCAACCGATCTC
GCTGCCCGCCTCAACGGACTTAGCCCCCAACAGCAACAACAAACACTGGCCACCCTCGTG
GCCGCGGCCACCGCCACCGTGCTGGGCCACCACACCCCCGAAAGCATCAGCCCAGCCACC
GCGTTCAAAGACCTCGGAATCGATTCGCTGACCGCCCTTGAACTGCGCAACACCCTCACC
CACAACACCGGCCTGGATCTGCCCCCCACCCTCATCTTCGATCACCCCACACCCACCGCG
CTAACCCAACACCTGCACACCCGACTCACCACCGGTGCCCTGGTGCCGGCTCCGGTGGTG
ATCGCAGCTGGTCGTACCGAGGAGCCGGTGGCGGTGGTGGGGATGGCGTGTCGTTTCCCC
GGTGGTGTCGCATCAGCGGATCAGTTGTGGGACTTGGTGATCGCTGGCCGTGATGTGGTG
GGTAATTTTCCGGCCGATCGGGGTTGGGATGTGGCGGGACTGTTTGATCCCGATCCGGAC
GCGGTCGGCAAAACCTACACCCGTTACGGCGCGTTCCTTGACGATGCGGCAGGTTTTGAT
GCCGGGTTCTTTGGGATCTCTCCACGGGAGGCACGCGCGATGGACCCCCAGCAGCGGCTG
CTGCTGGAGGTGTGCTGGGAAGCGCTAGAAACCGCGGGTATTCCCGCGCACACCTTGGCC
GGCACCTCCACCGGGGTATTCGTCGGAGCCGGGGCCCAGTCCTACGGCGCCACCAACTCC
GATGACGCTGAGGGGTATGCGATGACCGGCGGCGCGATCAGCGTCATGTCCGGCCGTATC
GCCTACACCTTGGGCCTAGAAGGTCCAGCGATCACCGTTGACACCGCCTGCTCGTCATCG
CTGGTGGCAATTCACCTGGCCTGCCAATCCTTACGCAACAACGAATCCCAGCTAGCACTG
GCCGGCGGCGTCACCGTGATGAGCACACCTGCGGTTTTCACCGATTTCTCCCGCCAACGC
GGCCTGGCCCCAGATGGACGCTGCAAAGCCTTCGCCGCTACCGCCGATGGCACCGGCTTT
GGTGAAGGCGCCGCGGTCTTGGTCCTTGAACGGCTCTCCGAGGCCCGCCGCAACAACCAC
CCGGTCCTTGCGATCGTCGCTGGATCGGCGATCAACCAAGACGGCGCATCCAACGGACTG
ACCGCACCCCACGGCCCGTCACAACAACGCGTCATCAACCAAGCACTAGCCAACGCCGGC
CTCACCCACGACCAGGTCGACGCCGTCGAAGCCCACGGCACCGGCACCACACTGGGTGAC
CCCATCGAAGCCGGCGCCCTACACGCCACCTACGGCCACCACCACACGCCCGATCAACCG
CTTTGGCTGGGATCCATCAAATCCAACATCGGCCACACCCAAGCCGCCGCCGGCGCCGCC
GGTGTGGTCAAGATGATCCAAGCCATCACCCACGCCACCTTGCCCGCCACCTTGCACGTC
GACCAACCCAGCCCCCACATCGACTGGTCCAGCGGCACAGTCCGACTCCTAACCGAGCCC
ATCCAATGGCCCAACACCGACCACCCCCGCACCGCGGCGGTGTCCTCATTCGGCATCAGC
GGCACCAACGCCCACCTCATCCTCCAACAACCCCCCACCCCCGACACCACACAAACCCCC
AACCCCACAACAGGTTCTGATCCCGCAGTGGGTTCTGATTCCGCAGTGGGTTCTGATCCC
GCAGTGGGTGTACTGGTGTGGCCGTTGTCAGCGCGTTCAGCGCCGGGGTTAAGCGCACAA
GCGGCCCGTCTGTACCAGCATCTCAGCGCCCACCCCGATCTGGATCCGATCGATGTAGCC
CACAGCCTGGCTACCACACGCAGCCACCACCCCCACCGCGCCACCATCACCACCAGCATT
GAGCACCACAGCGAAAACAACCACGACACAACCGATGCGCTGGCCGCACTGCACGCCCTG
GCCAACAACGGCACACACCCCCTGCTGAGCAGAGGCCTGCTGACCCCACAGGGCCCCGGC
AAAACAGTGTTCGTGTTCCCCGGACAGGGCAGTCAATACCCCGGCATGGGCGCAGATCTC
TACCGCCAATTCCCCGTGTTCGCCCACGCCCTCGACGAGGTCGCTGCGGCGCTGAACCCG
CATCTCGATGTTGCGTTGCTTGAGGTGATGTTCAGCCAACAAGACACTGCCATGGCGCAA
CTGCTGGACCAGACCTTCTATGCACAACCGGCGTTGTTCGCGCTGGGAACCGCTCTACAT
CGATTGTTCACCCACGCCGGTATCCACCCGGACTACCTGCTAGGCCACTCCATCGGAGAA
CTCACCGCGGCATACGCCGCCGGTGTGCTGTCACTGCAAGACGCAGCCACCTTGGTCACA
AGCCGAGGACGACTGATGCAATCCTGCACGCCCGGCGGGACGATGCTCGCACTACAAGCC
AGCGAAGCAGAAGTACAACCGCTGCTTGAAGGCCTAGACCACGCCGTGTCCATCGCCGCG
ATCAACGGAGCAACGTCGATCGTACTGTCAGGAGATCACGACAGCCTCGAACAAATCGGC
GAGCACTTCATTACCCAAGATCGACGTACCACCCGACTGCAGGTCAGTCACGCTTTCCAC
TCTCCACATATGGACCCCATCCTCGAACAATTCCGCCAGATCGCGGCCCAACTCACCTTC
AGCGCACCCACCCTGCCCATCTTGTCCAACCTCACCGGGCAGATCGCCCGCCACGACCAA
CTCGCCTCACCTGACTATTGGACCCAACAGCTACGTAACACTGTCCGGTTCCATGACACT
GTCGCTGCCCTGCTCGGGGCGGGTGAGCAGGTTTTCCTGGAACTTTCACCTCACCCGGTG
TTGACACAAGCGATCACCGACACCGTCGAACAAGCCGGCGGCGGCGGCGCAGCAGTGCCA
GCTCTACGCAAGGATCGCCCTGATGCTGTCGCGTTCGCTGCAGCACTCGGCCAGCTGCAC
TGCCATGGCATCAGCCCATCCTGGAATGTTCTTTACTGCCAGGCCCGCCCCCTCACACTG
CCCACCTACGCTTTCCAGCATCAGCGTTACTGGCTGCTGCCCACCGCTGGTGATTTCAGC
GGGGCCAATACCCACGCCATGCATCCGCTGCTAGACACCGCCACCGAACTGGCCGAAAAC
CGCGGATGGGTGTTCACCGGCCGGATCAGCCCACGCACCCAACCATGGCTAAACGAACAC
GCCGTCGAATCAGCCGTGCTGTTCCCGAACACCGGATTTGTCGAGCTAGCGCTGCATGTC
GCTGACCGTGCCGGATATTCCTCGGTCAACGAACTGATCGTGCACACCCCCCTGCTGCTC
GCTGGCCACGACACCGCGGATCTACAGATCACCGTCACCGACACCGATGACATGGGCCGG
CAGTCTCTTAACATCCACTCGCGCCCACATATCGGCCATGACAACACCACCACCGGCGAT
GAACAACCCGAGTGGGTCCTGCATGCCAGCGCAGTCCTGACCGCACAAACCACCGACCAC
AACCACCTCCCCCTAACGCCTGTGCCGTGGCCTCCACCCGGCACAGCCGCGATCGAGGTG
GATGACTTCTACGACGACCTGGCTGCACAGGGCTACAACTACGGCCCGACATTCCAAGGT
GTGCAACGGATATGGCGTGACCACGCCACACCCGATGTCATCTACGCCGAAGTTGAACTA
CCCGAAGACACCGACATCGACGGCTACGGCATCCACCCCGCCCTATTCGACGCCGCTTTA
CACCCCCTACTCGCCCTGACCCAACCCCCCACCAACGACACCGATGACACCAACACCGCA
GACACCGGGGACCAGGTGCGGCTGCCCTACGCCTTTACCGGCATCAGTTTGCACGCCACC
CACGCCACCCGATTGCGGGTACGGCTGACCCGTACCGGCGCCGATGCCATCACCGTGCAC
ACCAGTGACACCACCGGAGCCCCGGTGGCGATCATCGACTCATTGATCACCCGCCCCCTC
ACCACCGCCACAGGGTCTGCTCCGGCAACCACAGCAGCTGGCCTACTACACCTGAGCTGG
CCACCACACCCTGACACCACGACCGACACCGACACCGACACCGACACCGATGCCCTGCGG
TATCAGGTGATCGCCGAACCCACTCAACAACTGCCCCGCTACCTGCACGACCTACACACC
AGCACCGACCTGCACACCAGCACCACCGAAGCAGACGTGGTTGTGTGGCCGGTACCGGTG
CCCAGCAACGAAGAGCTCCAGGCACACCAAGCATCCGACACCGCGGTGTCTTCTCGGATA
CACACCCTGACCCGCCAAACACTTACCGTGGTGCAGGACTGGCTCACTCACCCCGACACC
ACCGGCACCCGACTGGTCATCGTGACCCGCCACGGCGTCAGCACCAGTGCCCACGACCCG
GTCCCCGACCTAGCCCACGCCGCAGTGTGGGGCCTGATCCGCAGCGCCCAAAACGAACAC
CCCGGACGCTTCACACTGCTCGACACCGACGACAACACCAACAGCGACACCCTCACCACC
GCCCTAACCCTGCCAACCCGCGAAAACCAACTGGCCATACGCCGCGACACCATCCACATC
CCCCGCCTGACCCGACACAGCAGTGACGGTGCGCTCACTGCGCCGGTGGTGGTAGATCCT
GAGGGCACGGTGTTGATCACCGGGGGGACCGGGACGCTGGGTGCCTTGTTCGCCGAGCAT
CTGGTTTCTGCCCATGGTGTCCGGCATCTGTTGTTGACCTCGCGGCGCGGACCTCAGGCC
CACGGTGCCACCGATCTGCAGCAGCGGCTCACCGATCTAGGTGCTCATGTCACCATCACG
GCCTGCGATATCAGCGACCCCGAAGCACTGGCCGCCCTGGTCAATTCAGTGCCCACACAA
CACCGTTTAACCGCGGTAGTGCACACCGCCGCGGTATTGGCCGACACCCCGGTCACCGAG
TTGACCGGCGATCAACTCGACCAGGTGCTGGCCCCCAAAATCGACGCGGCATGGCAGCTG
CACCAACTCACCTACGAACACAACCTGTCTGCATTCATCATGTTCTCGTCCATGGCCGGA
ATGATAGGCAGTCCCGGTCAGGGTAACTACGCGGCAGCCAACACCGCGTTAGATGCTCTC
GCCGACTACCGCCACCGCCTGGGCTTGCCCGCGACCAGCCTGGCCTGGGGCTACTGGCAG
ACTCACACCGGTCTCACCGCGCATCTAACCGATGTAGATCTAGCCCGCATGACCCGCCTG
GGTTTGATGCCCATCGCCACCAGCCACGGACTGGCCCTGTTCGATGCCGCCCTCGCCACC
GGACAGCCCGTTTCGATACCCGCCCCGATCAACACCCACACCCTGGCCCGACACGCCCGC
GACAACACCCTGGCCCCGATCCTGTCTGCGCTGATCACCACACCACGGCGCCGGGCGGCC
TCTGCCGCAACCGATCTCGCTGCCCGCCTCAACGGACTTAGCCCCCAACAGCAACAACAA
ACACTGGCCACCCTCGTGGCCGCGGCCACCGCCACCGTGCTGGGCCACCACACCCCCGAA
AGCATCAGCCCAGCCACCGCGTTCAAAGACCTCGGAATCGATTCGCTGACCGCCCTTGAA
CTGCGCAACACCCTCACCCACAACACCGGCCTGGATCTGCCCCCCACCCTCATCTTCGAT
CACCCCACACCCACCGCGCTAACCCAACACCTGCACACCCGACTCACACAAATTGAGAGC
CCAAATTCCGAAGACTCGATGCTGAACCTTAAAAATTTGGACCGAATTGAATCATATATC
TTCAGAAATTCGGGAGAAGATCGAGCTCACGTAATCGCTAATCGTTTACGGTCAATTCTC
TCGAAATGGGATGGCACCCGTAGTCCAGAATTACCTGCGGAACTCCATCTTGAATCGGCA
ACAGACGATGAGCTGTTTTCCCTAGCAAACATGTTTCGCACTCCAACCAGCGAAATTTCA
CCTACTCTAGAAGGCGGCCGTGGTGTCAACTGA
[0] KSQ19..390
[0] AT567..889
[0] malonyl-CoA761..765
[0] dh932..1105
[0] KR1444..1624
[0] ACP1724..1794
[1] KS1817..2190
[1] AT2372..2694
[1] malonyl-CoA2566..2570
[1] dh2737..2910
[1] KR3249..3429
[1] ACP3529..3599
[2] KS3622..3995
[2] AT4177..4499
[2] methylmalonyl-CoA not conserved YASHS(A->P)4368..4372
[2] dh4542..4715
[2] er5057..5360
[2] KR5370..5550
[2] ACP5650..5720
[3] KS5743..6116
[3] AT6298..6620
[3] methylmalonyl-CoA not conserved YASHS(A->P)6489..6493
[3] DH6663..6836
[3] KR7175..7355
[3] ACP7455..7525
[4] KS7547..7920
[4] AT8096..8418
[4] methylmalonyl-CoA not conserved YASHS(A->P)8287..8291
[4] DH8461..8634
[4] ER8976..9279
[4] KR9289..9469
[4] ACP9569..9639
[5] KS9662..10035
[5] AT10204..10517
[5] malonyl-CoA10391..10395
[5] KR10830..11006
[5] ACP11108..11178
[6] KS11201..11574
[6] AT11750..12072
[6] methylmalonyl-CoA not conserved YASHS(A->P)11941..11945
[6] DH12115..12288
[6] KR12621..12801
[6] ACP12901..12971
[7] KS12994..13367
[7] AT13543..13865
[7] methylmalonyl-CoA not conserved YASHS(A->P)13734..13738
[7] DH13908..14081
[7] ER14423..14726
[7] KR14736..14916
[7] ACP15016..15086
[8] KS15108..15481
[8] AT15663..15985
[8] malonyl-CoA15857..15861
[8] dh16028..16201
[8] KR16542..16722
[8] ACP16822..16892
[0] KSQ55..1170
[0] AT1699..2667
[0] malonyl-CoA2281..2295
[0] dh2794..3315
[0] KR4330..4872
[0] ACP5170..5382
[1] KS5449..6570
[1] AT7114..8082
[1] malonyl-CoA7696..7710
[1] dh8209..8730
[1] KR9745..10287
[1] ACP10585..10797
[2] KS10864..11985
[2] AT12529..13497
[2] methylmalonyl-CoA not conserved YASHS(A->P)13102..13116
[2] dh13624..14145
[2] er15169..16080
[2] KR16108..16650
[2] ACP16948..17160
[3] KS17227..18348
[3] AT18892..19860
[3] methylmalonyl-CoA not conserved YASHS(A->P)19465..19479
[3] DH19987..20508
[3] KR21523..22065
[3] ACP22363..22575
[4] KS22639..23760
[4] AT24286..25254
[4] methylmalonyl-CoA not conserved YASHS(A->P)24859..24873
[4] DH25381..25902
[4] ER26926..27837
[4] KR27865..28407
[4] ACP28705..28917
[5] KS28984..30105
[5] AT30610..31551
[5] malonyl-CoA31171..31185
[5] KR32488..33018
[5] ACP33322..33534
[6] KS33601..34722
[6] AT35248..36216
[6] methylmalonyl-CoA not conserved YASHS(A->P)35821..35835
[6] DH36343..36864
[6] KR37861..38403
[6] ACP38701..38913
[7] KS38980..40101
[7] AT40627..41595
[7] methylmalonyl-CoA not conserved YASHS(A->P)41200..41214
[7] DH41722..42243
[7] ER43267..44178
[7] KR44206..44748
[7] ACP45046..45258
[8] KS45322..46443
[8] AT46987..47955
[8] malonyl-CoA47569..47583
[8] dh48082..48603
[8] KR49624..50166
[8] ACP50464..50676

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [561-693]  G3DSA:3.40.366.10 [761-877]  G3DSA:3.40.366.10 [2366-2498]  G3DSA:3.40.366.10 [2566-2682]  G3DSA:3.40.366.10 [4171-4300]  G3DSA:3.40.366.10 [4368-4487]  G3DSA:3.40.366.10 [6292-6421]  G3DSA:3.40.366.10 [6489-6608]  G3DSA:3.40.366.10 [8090-8219]  G3DSA:3.40.366.10 [8287-8406]  G3DSA:3.40.366.10 [10196-10326]  G3DSA:3.40.366.10 [10391-10506]  G3DSA:3.40.366.10 [11744-11873]  G3DSA:3.40.366.10 [11941-12060]  G3DSA:3.40.366.10 [13537-13666]  G3DSA:3.40.366.10 [13734-13853]  G3DSA:3.40.366.10 [15657-15789]  G3DSA:3.40.366.10 [15857-15973]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1752-1767]  PS00012 [3557-3572]  PS00012 [5678-5693]  PS00012 [7483-7498]  PS00012 [9597-9612]  PS00012 [11136-11151]  PS00012 [12929-12944]  PS00012 [15044-15059]  PS00012 [16850-16865]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR006626 Parallel beta-helix repeat (Repeat)
 [1496-1518]  14.0000007335441 SM00710 [3301-3323]  14.0000007335441 SM00710 [5422-5444]  14.0000007335441 SM00710 [7227-7249]  14.0000007335441 SM00710 [9341-9363]  14.0000007335441 SM00710 [12673-12695]  14.0000007335441 SM00710 [14788-14810]  14.0000007335441 SM00710 [16594-16616]  14.0000007335441 SM00710
SM00710   PbH1
IPR009081 Acyl carrier protein-like (Domain)
 [1721-1797]  G3DSA:1.10.1200.10 [3526-3602]  G3DSA:1.10.1200.10 [5647-5723]  G3DSA:1.10.1200.10 [7452-7528]  G3DSA:1.10.1200.10 [9566-9642]  G3DSA:1.10.1200.10 [11109-11208]  G3DSA:1.10.1200.10 [12898-12974]  G3DSA:1.10.1200.10 [15013-15089]  G3DSA:1.10.1200.10 [16819-16895]  G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1724-1794]  PS50075 [3529-3599]  PS50075 [5650-5720]  PS50075 [7455-7525]  PS50075 [9569-9639]  PS50075 [11108-11178]  PS50075 [12901-12971]  PS50075 [15016-15086]  PS50075 [16822-16892]  PS50075
PS50075   ACP_DOMAIN
 [1717-1833]  2.10000267834031e-26 SSF47336 [3522-3638]  2.10000267834031e-26 SSF47336 [5643-5759]  2.10000267834031e-26 SSF47336 [7448-7563]  5.00000909915354e-27 SSF47336 [9562-9678]  2.10000267834031e-26 SSF47336 [11101-11217]  3.69999438558106e-26 SSF47336 [12894-13010]  2.30000440726534e-27 SSF47336 [15009-15124]  5.00000909915354e-27 SSF47336 [16815-16895]  4.49999046578037e-20 SSF47336
SSF47336   ACP_like
 [1728-1793]  5.69999999999999e-11 PF00550 [3533-3598]  5.69999999999999e-11 PF00550 [5654-5719]  5.69999999999999e-11 PF00550 [7459-7524]  9.10000000000001e-12 PF00550 [9573-9638]  5.69999999999999e-11 PF00550 [11112-11177]  1.3e-11 PF00550 [12905-12970]  5.69999999999999e-12 PF00550 [15020-15085]  9.10000000000001e-12 PF00550 [16826-16891]  9.10000000000001e-12 PF00550
PF00550   PP-binding
IPR011032 GroES-like (Domain)
 [5048-5189]  5.29999657550189e-28 SSF50129 [8967-9108]  5.29999657550189e-28 SSF50129 [14414-14555]  5.29999657550189e-28 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [9112-9217]  1.9e-18 PF00107 [14559-14664]  1.9e-18 PF00107
PF00107   ADH_zinc_N
IPR013968 Polyketide synthase, KR (Domain)
 [1444-1623]  6.49999999999992e-61 PF08659 [3249-3428]  6.49999999999992e-61 PF08659 [5370-5548]  1.09999999999999e-59 PF08659 [7175-7354]  6.49999999999992e-61 PF08659 [9289-9468]  6.49999999999992e-61 PF08659 [10830-11005]  2.59999999999998e-53 PF08659 [12621-12800]  6.49999999999992e-61 PF08659 [14736-14914]  6.40000000000004e-61 PF08659 [16542-16721]  6.49999999999992e-61 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [19-265]  6.70000000000005e-78 PF00109 [1817-2064]  1.9e-96 PF00109 [3622-3869]  7.90000000000016e-97 PF00109 [5743-5990]  6.7999999999999e-96 PF00109 [7547-7794]  9.3000000000001e-96 PF00109 [9662-9909]  1.9e-96 PF00109 [11201-11448]  6.70000000000006e-96 PF00109 [12994-13241]  5.99999999999995e-96 PF00109 [15108-15355]  1.39999999999997e-95 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [273-390]  2.50000000000001e-40 PF02801 [2072-2190]  2.99999999999998e-43 PF02801 [3877-3995]  2.99999999999998e-43 PF02801 [5998-6116]  1.70000000000001e-43 PF02801 [7802-7920]  2.99999999999998e-43 PF02801 [9917-10035]  2.99999999999998e-43 PF02801 [11456-11574]  1.70000000000001e-43 PF02801 [13249-13367]  1.70000000000001e-43 PF02801 [15363-15481]  2.99999999999998e-43 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [567-889]  2.79999999999994e-72 PF00698 [2372-2694]  2.79999999999994e-72 PF00698 [4177-4499]  5.00000000000001e-102 PF00698 [6298-6620]  5.00000000000001e-102 PF00698 [8096-8418]  5.00000000000001e-102 PF00698 [10204-10517]  4.2e-68 PF00698 [11750-12072]  5.00000000000001e-102 PF00698 [13543-13865]  5.00000000000001e-102 PF00698 [15663-15985]  2.79999999999994e-72 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [565-857]  1.90000694315261e-71 SSF52151 [2370-2662]  1.90000694315261e-71 SSF52151 [4175-4467]  5.50001754266469e-68 SSF52151 [6296-6588]  5.50001754266469e-68 SSF52151 [8094-8386]  5.50001754266469e-68 SSF52151 [10202-10489]  1.59998835313644e-72 SSF52151 [11748-12040]  5.50001754266469e-68 SSF52151 [13541-13833]  5.50001754266469e-68 SSF52151 [15661-15953]  1.90000694315261e-71 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [695-760]  2.49999811956465e-16 SSF55048 [2500-2565]  2.49999811956465e-16 SSF55048 [4302-4367]  1.69999922284049e-15 SSF55048 [6423-6488]  1.69999922284049e-15 SSF55048 [8221-8286]  1.69999922284049e-15 SSF55048 [10328-10390]  2.19999900980708e-16 SSF55048 [11875-11940]  1.69999922284049e-15 SSF55048 [13668-13733]  1.69999922284049e-15 SSF55048 [15791-15856]  2.49999811956465e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [19-276]  G3DSA:3.40.47.10 [277-443]  G3DSA:3.40.47.10 [1819-2076]  G3DSA:3.40.47.10 [2077-2242]  G3DSA:3.40.47.10 [3624-3881]  G3DSA:3.40.47.10 [3882-4047]  G3DSA:3.40.47.10 [5745-6002]  G3DSA:3.40.47.10 [6003-6168]  G3DSA:3.40.47.10 [7549-7806]  G3DSA:3.40.47.10 [7807-7972]  G3DSA:3.40.47.10 [9664-9921]  G3DSA:3.40.47.10 [9922-10087]  G3DSA:3.40.47.10 [11209-11460]  G3DSA:3.40.47.10 [11461-11626]  G3DSA:3.40.47.10 [12996-13253]  G3DSA:3.40.47.10 [13254-13419]  G3DSA:3.40.47.10 [15110-15367]  G3DSA:3.40.47.10 [15368-15533]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [17-392]  7.40000780398351e-85 SSF53901 [1809-2188]  1.50000965748778e-99 SSF53901 [3614-3993]  5.10003242202156e-99 SSF53901 [5735-6114]  7.40000780398351e-99 SSF53901 [7539-7918]  2.59998233910302e-99 SSF53901 [9654-10033]  1e-98 SSF53901 [11193-11572]  6.59996953923913e-99 SSF53901 [12986-13365]  9.90001804798383e-99 SSF53901 [15100-15479]  6.29998179434741e-99 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1444-1625]  G3DSA:3.40.50.720 [3249-3430]  G3DSA:3.40.50.720 [5145-5334]  G3DSA:3.40.50.720 [5370-5551]  G3DSA:3.40.50.720 [7175-7356]  G3DSA:3.40.50.720 [9064-9253]  G3DSA:3.40.50.720 [9289-9470]  G3DSA:3.40.50.720 [10830-11008]  G3DSA:3.40.50.720 [12621-12802]  G3DSA:3.40.50.720 [14511-14700]  G3DSA:3.40.50.720 [14736-14917]  G3DSA:3.40.50.720 [16543-16728]  G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1977-1993]  PS00606 [3782-3798]  PS00606 [5903-5919]  PS00606 [7707-7723]  PS00606 [9822-9838]  PS00606 [11361-11377]  PS00606 [13154-13170]  PS00606 [15268-15284]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [569-870]  6.19996040581186e-121 SM00827 [2374-2675]  6.19996040581186e-121 SM00827 [4179-4480]  2.2999842048857e-117 SM00827 [6300-6601]  2.2999842048857e-117 SM00827 [8098-8399]  2.2999842048857e-117 SM00827 [10206-10498]  1e-116 SM00827 [11752-12053]  2.2999842048857e-117 SM00827 [13545-13846]  2.2999842048857e-117 SM00827 [15665-15966]  6.19996040581186e-121 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1725-1797]  3.00000067992871e-30 SM00823 [3530-3602]  3.00000067992871e-30 SM00823 [5651-5723]  3.00000067992871e-30 SM00823 [7456-7528]  2.39999798157265e-32 SM00823 [9570-9642]  3.00000067992871e-30 SM00823 [11109-11181]  6.90001478563507e-29 SM00823 [12902-12974]  4.00000300869883e-32 SM00823 [15017-15089]  2.39999798157265e-32 SM00823 [16823-16895]  2.39999798157265e-32 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [932-1105]  8.00002659346736e-70 SM00826 [2737-2910]  6.69996745106047e-71 SM00826 [4542-4715]  2.89997807423186e-72 SM00826 [6663-6836]  2.89997807423186e-72 SM00826 [8461-8634]  3.39999972437719e-71 SM00826 [12115-12288]  3.39999972437719e-71 SM00826 [13908-14081]  2.89997807423186e-72 SM00826 [16028-16201]  6.69996745106047e-71 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [20-443]  SM00825 [1819-2242]  SM00825 [3624-4047]  SM00825 [5745-6168]  SM00825 [7549-7972]  SM00825 [9664-10087]  SM00825 [11203-11626]  SM00825 [12996-13419]  SM00825 [15110-15533]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1444-1624]  1.70000295590053e-57 SM00822 [3249-3429]  1.70000295590053e-57 SM00822 [5370-5550]  1.90000694315261e-54 SM00822 [7175-7355]  1.70000295590053e-57 SM00822 [9289-9469]  1.70000295590053e-57 SM00822 [10830-11006]  1.20000117458134e-41 SM00822 [12621-12801]  1.70000295590053e-57 SM00822 [14736-14916]  3.49999466863949e-57 SM00822 [16542-16722]  1.70000295590053e-57 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [5057-5360]  SM00829 [8976-9279]  SM00829 [14423-14726]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit