close all open/close all

CDS information : MUP_00410


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction137,735 / 137,361 / - [in whole cluster]
137,735 / 137,361 / - [in contig]
Locationcomplement(137361..137735) [in whole cluster]
complement(137361..137735) [in contig]
TypeCDS
Length375 bp (124 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative transposase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP041c, -, len: 124 aa. Putative transposase, similar in part to several transposases e.g. BAC67824 Putative transposase from Streptomyces avermitilis (239 aa), fasta scores: opt: 263, E(): 3.7e-12, (50.617% identity in 81 aa overlap); Q8KRD5 ISRh1 transposase-like protein from Rhodococcus erythropolis (236 aa), fasta score: opt: 257, E(): 9e-12, (64.286% identity in 56 aa overlap); Q982I3 Transposase from plasmid pMLa of Rhizobium loti (Mesorhizobium loti) (185 aa), fasta scores: opt: 200, E(): 1.5e-07, (37.209% identity in 86 aa overlap). Highly similar to MUP033.

close this sectionSequence

selected fasta
>[putative transposase]
MVLMVSVVPLADPGVCWGRSWRIIVTLVCIGDLEGLGRGQRVGKLHRRRPRPGDKWHLAE
VLVKVNGITRCLWRAIDQDGNVSDVLVRSRRNAKRHLLSAIDSRTEMADRFAVGYEVTVL
DAAA
selected fasta
>[putative transposase]
GTGGTGCTGATGGTTTCGGTTGTGCCGCTAGCGGATCCCGGGGTGTGCTGGGGCCGCAGT
TGGCGGATCATTGTCACGTTGGTGTGCATCGGCGACCTGGAAGGACTAGGAAGGGGTCAG
CGGGTGGGCAAGTTGCATCGACGTCGTCCCCGCCCGGGCGACAAGTGGCACCTGGCTGAG
GTGTTGGTGAAGGTCAACGGGATCACCCGTTGTCTGTGGCGTGCGATCGACCAGGACGGC
AACGTTTCAGACGTGTTGGTGCGGTCGCGGCGTAACGCCAAACGACATCTGCTCAGCGCC
ATCGATTCGCGAACCGAAATGGCTGACCGGTTCGCGGTCGGGTATGAGGTCACCGTTCTC
GATGCTGCCGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-18]  0.938 Signal
Eukaryota   
TMHMM No significant hit