close all open/close all

CDS information : MUP_00430


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction138,963 / 140,018 / + [in whole cluster]
138,963 / 140,018 / + [in contig]
Location138963..140018 [in whole cluster]
138963..140018 [in contig]
TypeCDS
Length1,056 bp (351 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative transposase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP043, -, len: 351 aa. Putative transposase, similar to several putative transposases from Streptomyces e.g BAC68344|Q82Q86 Putative transposase from Streptomyces avermitilis (354 aa), fasta scores: opt: 1146, E(): 1.1e-63, (52.493% identity in 341 aa overlap); O69923 Putative transposase from Streptomyces coelicolor (379 aa), fasta scores: opt: 742, E(): 1.5e-38, (39.339% identity in 333 aa overlap). And similar to transposases from Corynebacterium efficiens e.g. BAC18308|Q8FTR3 Putative transposase (409 aa), fasta scores: opt: 993, E(): 4e-54, (45.210% identity in 334 aa overlap); BAC17059|Q8CMH0 Putative transposase (412 aa), fasta scores: opt: 947, E(): 2.9e-51, (43.413% identity in 334 aa overlap). Also weakly similar to Q8VJ30 IS1547, transposase from M. tuberculosis (596 aa), fasta scores: opt: 474, E(): 7.4e-22, (35.347% identity in 350 aa overlap). Contains a Pfam match to entry PF02371, Transposase_20, Transposase IS116/IS110/IS902 family. Highly similar to MUP035 but longer.

close this sectionSequence

selected fasta
>[putative transposase]
MGRSSRAIIGGVDTHAATHHGAVIDSRGRLLADAEYPASGRGYAAMLTWMRSKGNLTKVG
VEGTGAYGAGLARYLHEQGVEVLEVPRPDRRIRRQRGKSDPIDAEAAARTVLAGRASGAS
KLVDGPIEAIRMLRVARSDAVKAKTAAVNALRAMLITTPDTLRSQLHGLSSAQLVAAYTK
LRPDAANLTDPVQAAKAALRSIATRTRQLELESQALRTQLDGLIKSVAPATSAVFGLGPD
TASALLVTIGDNPDRLRSEAAFARLCGVAPIPASSGKTHRHRLHRGGDRTGNHALHIAAV
VRLRYDPRSRAYADRRTSEGLSKPEIIRCQKRYLAREVFDALRTDFTKLNT
selected fasta
>[putative transposase]
ATGGGCCGGAGTTCACGAGCCATCATCGGCGGCGTGGATACGCACGCAGCAACTCATCAC
GGCGCGGTCATCGATTCACGTGGCCGGCTGCTCGCTGACGCCGAATACCCGGCCTCGGGG
CGCGGTTATGCCGCGATGCTGACGTGGATGCGCAGCAAAGGAAACCTCACGAAAGTTGGC
GTCGAAGGAACCGGCGCCTACGGGGCCGGGCTTGCCCGCTACCTGCACGAGCAGGGCGTC
GAGGTGCTTGAGGTGCCCCGCCCCGACCGGCGCATCCGTCGGCAGCGCGGCAAGAGCGAC
CCGATCGATGCTGAAGCCGCGGCACGAACCGTCTTGGCAGGTCGGGCAAGCGGAGCTTCG
AAGCTAGTCGATGGGCCGATCGAAGCCATCCGCATGCTGCGGGTAGCCCGCAGCGATGCG
GTCAAAGCCAAAACCGCCGCGGTCAACGCCCTGCGCGCGATGCTCATCACTACGCCCGAC
ACGCTGCGTTCTCAGCTACACGGCCTGTCTTCGGCCCAACTCGTTGCCGCATACACTAAG
TTACGTCCCGACGCGGCTAATCTCACCGACCCGGTTCAAGCCGCCAAAGCCGCGTTGCGT
TCGATCGCGACCCGCACACGCCAGCTCGAACTCGAATCACAGGCTCTGCGAACCCAACTC
GACGGACTCATCAAATCGGTCGCGCCCGCCACCAGCGCCGTCTTCGGGCTCGGGCCAGAC
ACCGCATCCGCGCTGCTGGTCACCATCGGAGACAACCCCGACCGGCTACGCAGCGAGGCG
GCGTTCGCCCGCCTATGCGGAGTAGCCCCGATCCCCGCCTCATCCGGGAAAACCCACCGC
CATCGGCTACACCGCGGCGGCGACAGAACCGGCAACCACGCCCTGCACATCGCCGCAGTC
GTGCGCCTGCGCTACGACCCACGCAGCCGCGCCTACGCCGACCGCCGCACCTCCGAAGGC
CTATCGAAGCCCGAAATCATCCGCTGCCAGAAGCGTTACCTTGCCCGCGAAGTCTTTGAC
GCGCTACGCACTGACTTCACCAAACTCAACACTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002525 Transposase, IS111A/IS1328/IS1533, N-terminal (Domain)
 [10-149]  1.99999999999999e-26 PF01548
PF01548   DEDD_Tnp_IS110
IPR003346 Transposase, IS116/IS110/IS902 (Family)
 [234-313]  2.1e-17 PF02371
PF02371   Transposase_20
IPR016040 NAD(P)-binding domain (Domain)
 [55-154]  0.00011 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit