close all open/close all

CDS information : MUP_00440


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction140,148 / 140,008 / - [in whole cluster]
140,148 / 140,008 / - [in contig]
Locationcomplement(140008..140148) [in whole cluster]
complement(140008..140148) [in contig]
TypeCDS
Length141 bp (46 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative truncated transposase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP044c, -, len: 46 aa. Putative truncated transposase, similar to several transposases from Xanthomonas e.g. Q8P9Q3 IS1477 transposase from Xanthomonas campestris (88 aa), fasta scores: opt: 106, E(): 0.2, (55.882% identity in 34 aa overlap); and Q8PRI1 ISxac2 transposase from Xanthomonas axonopodis (88 aa), fasta scores: opt: 104, E(): 0.29, (48.571% identity in 35 aa overlap). And some similarity to MUP051.

close this sectionSequence

selected fasta
>[putative truncated transposase]
MDVDAGKELKELREQNTRLKRLPAETELVKDALREVAKDAPIDVKC
selected fasta
>[putative truncated transposase]
ATGGACGTGGACGCGGGCAAGGAGCTCAAAGAACTGCGGGAACAGAACACCCGCCTGAAG
CGGCTGCCGGCCGAGACCGAGCTGGTGAAGGACGCCCTGCGGGAGGTCGCCAAGGACGCT
CCTATAGATGTCAAGTGTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit