close all open/close all

CDS information : MUP_00450


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction140,606 / 141,592 / + [in whole cluster]
140,606 / 141,592 / + [in contig]
Location140606..141592 [in whole cluster]
140606..141592 [in contig]
TypeCDS
Length987 bp (328 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative acyltransferase
Product (GenBank)probable beta-ketoacyl synthase-like protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP045, -, len: 328 aa. Probable beta-ketoacyl synthase-like protein, weakly similar to Q9KHD3 Type III beta-ketoacyl synthase-like protein from Streptomyces griseus subsp. griseus (345 aa), fasta scores: opt: 238, E(): 1e-07, (26.282% identity in 312 aa overlap). Most similar to Q54816 Daunorubicin-doxorubicin polyketide synthase from Streptomyces peucetius (353 aa), fasta scores: opt: 301, E(): 9.1e-12, (31.672% identity in 341 aa overlap); and also similar to several 3-oxoacyl-(acyl-carrier-protein) synthases e.g. Q9A8I4 3-oxoacyl-(acyl-carrier-protein) synthase III from Caulobacter crescentus (322 aa), fasta scores: opt: 259, E(): 4.3e-09, (26.935% identity in 323 aa overlap).
Reference
ACC
PmId
[14736915] Giant plasmid-encoded polyketide synthases produce the macrolide toxin of Mycobacterium ulcerans. (Proc Natl Acad Sci U S A. , 2004)
[16008585] Modulation of the host immune response by a transient intracellular stage of Mycobacterium ulcerans: the contribution of endogenous mycolactone toxin. (Cell Microbiol. , 2005)
Related Reference
ACC
Q67G55
NITE
Heda_00030
PmId
[19942143] In vivo and in vitro analysis of the hedamycin polyketide synthase. (Chem Biol. , 2009)
ACC
Q54816
NITE
Adria_00290
PmId
[10419974] The Streptomyces peucetius dpsC gene determines the choice of starter unit in biosynthesis of the daunorubicin polyketide. (J Bacteriol. , 1999)
[10423255] Purification and properties of the Streptomyces peucetius DpsC beta-ketoacyl:acyl carrier protein synthase III that specifies the propionate-starter unit for type II polyketide biosynthesis. (Biochemistry. , 1999)

close this sectionSequence

selected fasta
>putative acyltransferase [probable beta-ketoacyl synthase-like protein]
MIWNDIYISGTGRFIPSMRPINDIQVDGVPNDHTIVQSDYISFTEADEPATVMATRAATE
ALTTSELVSADVGVLIYAAIIGDAHHFAPVCHVQRVLRAPDALAFELSAASNGGTQGIAV
AANLMTADASVKAALVCTAYRHPIDIISRWSSGMVFGDGAAAAVLSRDGGMVRLISGYHG
SLPELEVLARNRSNERLGFVLPDVGLGKYLTAIARMYQAVIAQVLEEAQTSIAEIDYFGL
IGIGIPSLTATILEPNGIPVNKTSWGLLRQMGHVGACDPLLSLNHLFEQNVLKRGDKVLL
LGGGVGYRLTCIVAEIAMNPGVPGHSTS
selected fasta
>putative acyltransferase [probable beta-ketoacyl synthase-like protein]
GTGATTTGGAATGACATCTACATAAGTGGAACGGGGCGTTTCATCCCGTCAATGCGACCA
ATTAATGATATCCAGGTCGACGGTGTTCCGAATGATCATACTATCGTGCAATCCGATTAC
ATTTCCTTCACCGAAGCCGATGAGCCGGCTACAGTCATGGCCACGCGCGCTGCAACCGAA
GCGCTGACCACTTCCGAGCTAGTATCCGCTGATGTTGGCGTCTTGATATATGCCGCGATC
ATCGGCGATGCGCATCATTTTGCCCCCGTATGTCACGTCCAAAGAGTCCTCCGGGCGCCC
GATGCGCTGGCATTCGAACTTTCCGCAGCAAGTAACGGTGGAACACAAGGCATCGCAGTT
GCTGCAAATCTCATGACAGCTGACGCGTCCGTGAAAGCTGCACTCGTTTGTACAGCTTAC
CGGCACCCGATCGATATTATCAGCCGTTGGTCGTCAGGTATGGTATTCGGCGATGGAGCA
GCCGCCGCCGTGCTTTCAAGAGACGGCGGAATGGTGCGATTGATTTCCGGGTATCACGGC
TCACTGCCGGAGCTAGAGGTTCTTGCTAGAAATCGATCCAACGAACGACTTGGCTTTGTG
CTGCCAGACGTCGGGTTAGGAAAATACCTAACTGCTATAGCGCGGATGTACCAAGCGGTA
ATTGCGCAAGTACTAGAAGAGGCACAAACTAGTATTGCCGAGATCGACTATTTCGGCCTG
ATCGGTATAGGAATTCCAAGTCTCACAGCGACTATCTTAGAACCCAACGGTATTCCAGTT
AATAAAACATCCTGGGGTTTGCTAAGACAAATGGGCCACGTTGGAGCTTGCGATCCCCTG
CTGAGCCTTAACCACCTATTCGAGCAGAATGTCCTCAAGCGCGGCGACAAAGTCCTACTC
CTAGGTGGCGGGGTGGGGTATCGATTGACATGCATTGTGGCTGAAATCGCCATGAATCCC
GGCGTGCCCGGACACTCCACTTCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013747 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C-terminal (Domain)
 [225-315]  4.70000000000001e-16 PF08541
PF08541   ACP_syn_III_C
IPR013751 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III (Domain)
 [105-169]  1.4e-09 PF08545
PF08545   ACP_syn_III
IPR016038 Thiolase-like, subgroup (Domain)
 [4-160]  2.90000000000001e-20 G3DSA:3.40.47.10 [161-314]  3.2e-17 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [3-316]  2.800005042611e-22 SSF53901
SSF53901   Thiolase-like
SignalP No significant hit
TMHMM No significant hit