close all open/close all

CDS information : MUP_00460


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction142,322 / 142,615 / + [in whole cluster]
142,322 / 142,615 / + [in contig]
Location142322..142615 [in whole cluster]
142322..142615 [in contig]
TypeCDS
Length294 bp (97 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)possible membrane protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP046, -, len: 97 aa. Possible membrane protein, some similarity to Q92RR3 Hypothetical protein R00794 from Rhizobium meliloti (275 aa), E(): 26, (36.634% identity in 101 aa overlap). Contains a membrane spanning region between aa 24 to 46.

close this sectionSequence

selected fasta
>[possible membrane protein]
MGWRWWLRGAGEGDGGSDEVKGALLVGGGVASIGVGLVVWVKLTSLRVRVARCSSRPLKL
RSVAPLASWWRAALVLAAAERWAGATGFSRAGGFSSV
selected fasta
>[possible membrane protein]
GTGGGTTGGCGTTGGTGGCTACGCGGCGCTGGTGAGGGGGATGGTGGTTCCGATGAGGTC
AAAGGCGCGTTGTTGGTCGGGGGTGGGGTGGCGAGCATCGGGGTCGGGTTGGTGGTGTGG
GTGAAGTTGACGTCGTTGCGGGTCAGGGTTGCCAGGTGCTCGAGCAGGCCGCTGAAGCTG
CGTAGCGTGGCTCCGTTGGCGTCTTGGTGGCGTGCGGCTTTGGTTTTGGCGGCAGCTGAG
CGTTGGGCGGGTGCGACAGGGTTTTCCCGGGCTGGTGGGTTTTCGTCGGTATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-1]  Signal-anchor
Eukaryota   
TMHMM
 [24-46]  Transmembrane (o-i)
Transmembrane 1