close all open/close all

CDS information : MUP_00490


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction144,693 / 144,304 / - [in whole cluster]
144,693 / 144,304 / - [in contig]
Locationcomplement(144304..144693) [in whole cluster]
complement(144304..144693) [in contig]
TypeCDS
Length390 bp (129 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative transposase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP049c, -, len: 129 aa. Putative transposase, similar to several e.g. Q54335 Similar to ORF1 of the IS3 family from Streptomyces lividans (103 aa), fasta scores: opt: 225, E(): 2.9e-07, (44.565% identity in 92 aa overlap); and Q8XFW6 transposase from Brucella melitensis (93 aa), fasta scores: opt: 207, E(): 3.7e-06, (38.043% identity in 92 aa overlap); Q98A50 Transposase from Rhizobium loti (Mesorhizobium loti) (98 aa), fasta scores: opt: 204, E(): 6e-06, (37.234% identity in 94 aa overlap); Q8UJV4 Transposase from Agrobacterium tumefaciens plasmid AT (strain C58 / ATCC 33970) (96 aa), fasta scores: opt: 199, E(): 1.2e-05, (37.634% identity in 93 aa overlap). Contains a Pfam match to entry PF01527 Transposase_8, Transposase. Contains a helix turn helix motif between aa 58->79, tandard_deviations: 5.30, Score 1795.000.

close this sectionSequence

selected fasta
>[putative transposase]
MAAQPRQSWSSCDLSGPDTPGPIRPLTPLPRQSLPEIRRRFDPEFREGAVRIVRETGKPI
AQVARELGVNAGTLGNWVAKDRAEREGSQGLSTDGVAELKRLRSEVAELRMERDVLKRSV
VLWVKEATR
selected fasta
>[putative transposase]
ATGGCTGCACAGCCACGACAGTCTTGGTCATCATGCGACCTTTCCGGCCCCGACACACCG
GGGCCGATCAGGCCGCTTACACCCTTACCGCGACAGTCCCTGCCAGAGATACGGAGAAGG
TTCGATCCGGAGTTCCGGGAAGGGGCGGTACGGATCGTTCGGGAGACCGGTAAGCCGATC
GCCCAGGTTGCTCGAGAGTTGGGTGTCAACGCGGGCACGCTGGGTAACTGGGTTGCTAAA
GACCGCGCCGAAAGGGAAGGTAGCCAGGGGCTCTCGACTGATGGCGTGGCGGAGTTGAAG
CGGCTGCGCAGCGAGGTAGCTGAGCTTCGGATGGAGCGTGATGTCCTCAAGCGATCCGTG
GTCCTGTGGGTGAAGGAGGCGACGAGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002514 Transposase IS3/IS911family (Family)
 [37-112]  3.4e-16 PF01527
PF01527   HTH_Tnp_1
SignalP No significant hit
TMHMM No significant hit