close all open/close all

CDS information : MUP_00510


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction146,252 / 146,533 / + [in whole cluster]
146,252 / 146,533 / + [in contig]
Location146252..146533 [in whole cluster]
146252..146533 [in contig]
TypeCDS
Length282 bp (93 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative transposase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP051, -, len: 93 aa. Putative transposase, similar to several transposases from Rhizobium loti (Mesorhizobium loti) e.g. Q8KHM1 Putative insertion element transposase protein (88 aa), fasta scores: opt: 254, E(): 2.3e-10, (48.889% identity in 90 aa overlap). And weakly similar to several transposases from Yersinia e.g. O68709 Putative transposase from Yersinia pestis (88 aa), fasta scores: opt: 234, E(): 5.3e-09, (37.778% identity in 90 aa overlap). And some similarity to MUP044. Contains a Pfam match to entry PF01527, Transposase_8, Transposase. Contains helix turn helix motif between aa 27->48, Standard_deviations: 4.91, score 1680.00.

close this sectionSequence

selected fasta
>[putative transposase]
MAGRKRYSAEDIVRKLRRADELAAAGSSGEQIAAELGVSAATLYNWRRAYGGMDLDAAKE
LKELREQNGRLKRLLADAELEKDALREVAKVKF
selected fasta
>[putative transposase]
GTGGCTGGTCGTAAGAGGTATTCCGCCGAAGACATCGTGCGCAAGCTGCGCCGCGCTGAT
GAGCTGGCCGCCGCGGGCAGTTCAGGTGAGCAGATCGCCGCCGAGCTGGGGGTATCGGCG
GCCACGCTGTACAACTGGCGGCGGGCCTACGGGGGAATGGACCTCGACGCCGCCAAGGAG
CTCAAGGAGCTGCGTGAGCAAAACGGGCGGCTCAAACGGCTGCTGGCTGATGCCGAGCTG
GAAAAAGACGCGTTGCGTGAGGTCGCCAAAGTAAAATTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002514 Transposase IS3/IS911family (Family)
 [1-76]  6.3e-14 PF01527
PF01527   HTH_Tnp_1
SignalP
 [1-33]  0.133 Signal
Bacteria, Gram-negative   
TMHMM No significant hit