close all open/close all

CDS information : MUP_00520


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction146,563 / 147,396 / + [in whole cluster]
146,563 / 147,396 / + [in contig]
Location146563..147396 [in whole cluster]
146563..147396 [in contig]
TypeCDS
Length834 bp (277 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative transposase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP052, -, len: 277 aa. Putative transposase, weakly similar to several transposases e.g Q89TF0 Blr2054 protein from Bradyrhizobium japonicum (290 aa), fasta scores: E(): 1.9e-27, (38.224% identity in 259 aa overlap); Q8U751 IS3 family transposase from Agrobacterium tumefaciens (strain C58 / ATCC 33970) (309 aa), fasta scores: opt: 549, E(): 1.3e-29, (39.068% identity in 279 aa overlap); Q8KJC6 Putative transposase for insertion sequence from Rhizobium loti (Mesorhizobium loti) (309 aa), fasta scores: opt: 528, E(): 2.5e-25 (35.836% identity in 293 aa overlap). Contains a Pfam match to PF00665 rve, Integrase core domain and a PS50316 histidine-rich region.

close this sectionSequence

selected fasta
>[putative transposase]
MFKKVLSISERLACKAVGLARSTYRRVRIVDTPANPDAQLRAWLRSYATKHPCHGFRRAW
SALRYDEHHQVNKKKIHRLWCQEGLQVAARSPRKRGGVASVPPIIADAPRMVWALDFQFD
STIDGAAIKIASMVDEHTRESLLDMTQRSITAEALVDELERVFTTAGGPPKVLRMDNGPE
LISQALQQFCHGKVGVTYIPPGQPWNNGYVESFNSRLRKECLNRNYWTDLLEAKVVIGDF
KHEHHHRHRHSSLGYRTPAEYAAQCRHTHHPMACDIN
selected fasta
>[putative transposase]
ATGTTCAAAAAGGTGTTGAGCATCTCAGAACGGCTGGCGTGCAAAGCGGTTGGGCTGGCC
CGTTCAACCTACCGACGTGTGCGTATCGTCGACACCCCCGCGAACCCGGATGCCCAGCTG
CGAGCCTGGCTGCGCTCCTATGCCACCAAACACCCCTGCCATGGGTTCCGACGTGCCTGG
TCGGCGTTGCGCTACGACGAGCACCACCAGGTCAACAAGAAAAAGATCCACCGGCTGTGG
TGCCAAGAAGGCCTGCAAGTCGCCGCTCGCTCCCCCCGTAAACGCGGTGGTGTGGCTTCG
GTGCCCCCGATCATCGCCGATGCCCCCAGGATGGTCTGGGCGCTGGATTTCCAGTTTGAT
TCCACTATCGACGGTGCGGCGATCAAAATCGCCTCCATGGTCGACGAGCACACCCGCGAG
TCGCTGCTGGACATGACCCAGCGCTCCATCACCGCCGAGGCGCTCGTCGACGAGCTCGAG
CGGGTGTTCACCACTGCCGGCGGCCCACCCAAGGTGCTGCGTATGGACAATGGCCCAGAG
CTGATTTCTCAAGCGTTGCAGCAGTTTTGCCACGGCAAGGTCGGGGTCACCTACATCCCA
CCAGGTCAGCCCTGGAACAACGGATACGTCGAATCCTTCAACAGTCGCCTGCGAAAGGAG
TGCCTGAACCGCAACTACTGGACTGACCTGCTCGAAGCCAAGGTGGTGATCGGCGATTTC
AAACACGAACACCACCACCGCCACCGCCACTCATCGCTGGGCTACCGCACTCCGGCCGAG
TACGCTGCCCAGTGCAGGCACACCCACCACCCCATGGCCTGTGACATCAACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001584 Integrase, catalytic core (Domain)
 [105-266]  PS50994
PS50994   INTEGRASE
IPR012337 Ribonuclease H-like domain (Domain)
 [102-270]  1.70000295590054e-28 SSF53098
SSF53098   RNaseH_fold
IPR025948 HTH-like domain (Domain)
 [37-91]  7.5e-09 PF13276
PF13276   HTH_21
SignalP No significant hit
TMHMM No significant hit