close all open/close all

CDS information : MUP_00530


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction148,859 / 147,546 / - [in whole cluster]
148,859 / 147,546 / - [in contig]
Locationcomplement(147546..148859) [in whole cluster]
complement(147546..148859) [in contig]
TypeCDS
Length1,314 bp (437 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)probable cytochrome p450 150 cyp150
Gene
Gene (GenBank)cyp150
EC number
Keyword
  • side chain C-12 hydroxylate
Note
Note (GenBank)
  • MUP053c, cyp150, len: 437 aa. Probable cyp150, cytochrome p450 (EC 1.14.-.-), similar to O08464|C140_MYCTU|Rv1880c Probable cytochrome P450 140 from M. tuberculosis (438 aa), fasta scores: opt: 1873, E(): 6.7e-117, (62.529% identity in 435 aa overlap). And weakly similar to numerous others e.g. Q89G11|BAC51802 Bll6537 protein from Bradyrhizobium japonicum (433 aa), fasta scores: opt: 755, E(): 6.1e-41 (34.925% identity in 398 aa overlap); and Q9X8Q3 Putative cytochrome P450 from Streptomyces coelicolor (411 aa), fasta scores: E(): 2.9e-36, (34.063% identity in 411 aa overlap). Contains a Pfam match to entry PF00067, Cytochrome P450. Belongs to the cytochrome P450 family.
Reference
ACC
PmId
[14736915] Giant plasmid-encoded polyketide synthases produce the macrolide toxin of Mycobacterium ulcerans. (Proc Natl Acad Sci U S A. , 2004)
Related Reference
ACC
Q00441
PmId
[2011746] An erythromycin derivative produced by targeted gene disruption in Saccharopolyspora erythraea. (Science. , 1991)
[1732208] Characterization of Saccharopolyspora erythraea cytochrome P-450 genes and enzymes, including 6-deoxyerythronolide B hydroxylase. (J Bacteriol. , 1992)
[7749919] Structure of cytochrome P450eryF involved in erythromycin biosynthesis. (Nat Struct Biol. , 1995)

close this sectionSequence

selected fasta
>putative cytochrome P450 [probable cytochrome p450 150 cyp150]
MRQRLNWIAAHGLLRGTARLAARLGDVQSRLVADPMVMANPAPFCDELRAIGPVVSSYGT
HLVVSHAIAHELLRSEDFEVVSLGSNLPAPMRWLERRTRDDTPHLLLPPSLLAVEPPNHT
RYRKAVSSVFTPKAVAGLRDHVEETASALLDQLTDQASAVDIIARYCSQLPVAVICDILG
VPSRDRNRVLKFGQLAGPCLDFGLTWRQHQQVRQGLQGLHFWITEHLEELRSNPGDDLMS
QMIHASENGSSETHLHATEVRMIGLVLGASFATTMDLLGNGIQVLLDAPELRDALSQRPQ
LWPNAVEEILRLEPPVQLAGRMARKDTEVAGTAIKRGQLVAIYLGAVNRDPSVFADPHRF
DITRANANRHLAFSGGRHFCLGAALARVEGEVGLRMLFERFPDVRAAGPGNRRDTRTLRG
WSQLPVQLGAARSMAIR
selected fasta
>putative cytochrome P450 [probable cytochrome p450 150 cyp150]
GTGAGGCAGAGATTGAACTGGATTGCGGCGCACGGGTTGCTCCGCGGCACCGCGCGGTTA
GCGGCCCGGCTGGGCGACGTGCAGTCGCGGCTGGTGGCAGATCCCATGGTTATGGCAAAC
CCGGCGCCATTTTGCGATGAATTGAGGGCAATCGGCCCTGTGGTGTCGAGCTACGGCACC
CACCTCGTCGTTAGTCATGCCATCGCCCATGAACTGCTTCGGTCCGAAGACTTCGAAGTG
GTCTCGCTCGGATCGAACTTGCCGGCACCAATGCGCTGGCTAGAGCGCCGCACTCGGGAC
GATACGCCCCATCTGCTGCTGCCGCCGTCGTTGCTGGCCGTTGAGCCGCCGAATCACACG
CGCTATCGCAAGGCAGTGTCCTCGGTGTTCACGCCGAAAGCAGTAGCCGGATTACGCGAT
CATGTCGAAGAGACTGCGTCGGCGCTGTTGGATCAGCTCACCGACCAGGCTAGTGCCGTC
GACATCATAGCCCGCTACTGCTCCCAGCTGCCGGTCGCGGTCATTTGTGACATCTTAGGC
GTGCCCAGTCGAGACCGAAACCGTGTTCTCAAGTTCGGTCAGCTGGCGGGGCCCTGCTTG
GATTTTGGGCTCACATGGCGTCAGCACCAGCAGGTGCGGCAAGGGCTCCAAGGACTCCAC
TTCTGGATCACCGAGCACCTCGAGGAATTGCGGTCTAACCCCGGTGACGATCTGATGAGT
CAAATGATCCACGCAAGTGAAAATGGCTCCTCGGAAACACACCTCCACGCAACCGAAGTG
CGGATGATCGGGCTGGTGTTGGGCGCCAGTTTCGCAACAACGATGGACCTGTTAGGCAAC
GGGATTCAGGTGTTGTTGGACGCGCCCGAACTGCGGGACGCGTTGAGTCAGCGCCCGCAA
CTTTGGCCCAACGCGGTAGAAGAGATCCTGCGGTTGGAGCCACCGGTTCAGCTCGCCGGA
CGAATGGCTCGCAAGGACACCGAGGTGGCGGGTACCGCAATCAAGCGGGGCCAGCTGGTG
GCGATCTATCTGGGGGCGGTCAACCGTGATCCGTCCGTGTTCGCCGATCCGCACCGCTTT
GACATCACACGAGCCAACGCCAACCGGCATCTCGCATTCTCCGGTGGCCGCCACTTCTGC
CTCGGTGCCGCCCTTGCCCGCGTCGAAGGCGAAGTCGGATTGAGAATGCTCTTCGAGCGC
TTCCCTGACGTGCGCGCCGCAGGCCCCGGAAATAGACGTGATACTCGAACTCTGCGGGGT
TGGTCGCAGCTGCCGGTCCAGTTGGGCGCAGCACGATCGATGGCTATCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [203-401]  1.3e-24 PF00067
PF00067   p450
 [41-428]  2.59998233910302e-82 SSF48264
SSF48264   Cytochrome_P450
 [34-428]  9.69999999999989e-91 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002397 Cytochrome P450, B-class (Family)
 [114-125]  2.30000440726534e-47 PR00359 [161-177]  2.30000440726534e-47 PR00359 [178-193]  2.30000440726534e-47 PR00359 [221-243]  2.30000440726534e-47 PR00359 [304-315]  2.30000440726534e-47 PR00359 [321-348]  2.30000440726534e-47 PR00359 [349-364]  2.30000440726534e-47 PR00359 [371-380]  2.30000440726534e-47 PR00359 [380-391]  2.30000440726534e-47 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [373-382]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit