close all open/close all

CDS information : MUP_00540


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction149,359 / 148,856 / - [in whole cluster]
149,359 / 148,856 / - [in contig]
Locationcomplement(148856..149359) [in whole cluster]
complement(148856..149359) [in contig]
TypeCDS
Length504 bp (167 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)possible integrase fragment
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP054c, -, len: 167 aa. Possible integrase fragment, weakly similar to several e.g. AAO22922 Integrase/recombinase from Myxococcus xanthus (300 aa), fasta scores: opt: 176, E(): 0.00018, (37.4% identity in 107 aa overlap); Q8NNZ9 Integrase from Corynebacterium glutamicum (Brevibacterium flavum) (308 aa), fasta scores: opt: 169, E(): 0.00054, (33.33% identity in 84 aa overlap); and Q8L3A3 Putative integrase/recombinase Xer from Bacillus stearothermophilus (304 aa), fasta scores: opt: 168, E(): 0.00063, (33.02% identity in 106 aa overlap). Contains a Pfam match to entry PF00589 Phage_integrase Phage integrase family.

close this sectionSequence

selected fasta
>[possible integrase fragment]
MMAAQPRQSWSSCDLSGPDTPGPIRPLTPLPRQSLENCRNRLTPVDVALFRGLGSHRDRA
IVLAMLLGGLRAGEVRRLLLADVDQGRRQLRVVGKGGRERVVPVDDAFFAELASYLSHQQ
QCPQSTAVIPCGYRRQRCDATGTDDADLISRSTRRTMQLMYLPKEAS
selected fasta
>[possible integrase fragment]
GTGATGGCTGCACAGCCACGACAGTCTTGGTCATCATGCGACCTTTCCGGCCCCGACACA
CCGGGGCCGATCAGGCCGCTTACACCCTTACCGCGACAGTCCCTAGAAAACTGCCGGAAT
CGCTTGACTCCCGTGGATGTGGCGTTGTTTCGCGGCCTTGGGTCGCACCGGGACCGGGCG
ATCGTGTTAGCGATGCTGCTTGGCGGGCTGCGAGCCGGAGAGGTCCGCCGACTGTTACTC
GCCGATGTCGACCAGGGACGCCGCCAGTTGCGTGTGGTCGGTAAGGGCGGCCGGGAACGT
GTGGTCCCCGTCGATGACGCGTTCTTCGCCGAACTTGCTTCCTACCTGAGCCATCAACAA
CAATGTCCACAATCTACGGCTGTAATACCATGCGGGTATCGACGACAAAGGTGCGATGCG
ACAGGCACAGACGACGCCGATCTCATATCAAGATCAACCCGTCGCACGATGCAACTTATG
TATTTACCGAAGGAGGCCTCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002104 Integrase, catalytic (Domain)
 [55-138]  9.50000000000001e-09 PF00589
PF00589   Phage_integrase
IPR011010 DNA breaking-rejoining enzyme, catalytic core (Domain)
 [40-130]  2.49999811956465e-13 SSF56349
SSF56349   DNA_brk_join_enz
IPR013762 Integrase-like, catalytic core (Domain)
 [53-134]  4.6e-16 G3DSA:1.10.443.10
G3DSA:1.10.443.10   Phage_intgr_like
SignalP No significant hit
TMHMM No significant hit