close all open/close all

CDS information : MUP_00560


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction151,242 / 150,862 / - [in whole cluster]
151,242 / 150,862 / - [in contig]
Locationcomplement(150862..151242) [in whole cluster]
complement(150862..151242) [in contig]
TypeCDS
Length381 bp (126 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP056c, -, len: 126 aa. Hypothetical protein.

close this sectionSequence

selected fasta
>[hypothetical protein]
MHQPADEHTAAAEVEFATTTLQNLLHQIEVGNANAAAYPRPGRYTYLVSHAWADRTTIHL
VYTAPPSDITWGLVRDTRESLIDPGGWNSVDDAPRYYYLLDLDENWPGHALRQAGDDPHA
IRWRGD
selected fasta
>[hypothetical protein]
GTGCATCAGCCAGCCGACGAACACACGGCTGCCGCCGAGGTTGAGTTCGCCACCACCACC
CTGCAAAACCTGCTTCACCAAATCGAGGTCGGCAACGCCAACGCAGCGGCCTATCCGCGC
CCTGGCCGCTACACCTACCTGGTGTCGCACGCCTGGGCCGACCGCACCACGATCCATCTC
GTATACACAGCGCCGCCCTCAGACATCACATGGGGACTTGTTCGCGACACCAGGGAATCC
CTGATCGATCCCGGCGGGTGGAACTCGGTCGATGATGCGCCGCGCTACTACTACCTACTC
GATCTCGACGAAAACTGGCCGGGCCACGCTTTACGCCAAGCCGGGGACGATCCCCATGCC
ATCCGTTGGCGCGGTGACTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-35]  0.281 Signal
Bacteria, Gram-positive   
TMHMM No significant hit