close all open/close all

CDS information : MUP_00570


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction152,117 / 151,341 / - [in whole cluster]
152,117 / 151,341 / - [in contig]
Locationcomplement(151341..152117) [in whole cluster]
complement(151341..152117) [in contig]
TypeCDS
Length777 bp (258 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)possible lipoprotein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP057c, -, len: 258 aa. Possible lipoprotein, weakly similar to Q49597 MK35 lipoprotein precursor from Mycobacterium kansasii (225 aa), fasta scores: opt: 139, E(): 0.21, (27.059% identity in 170 aa overlap); and weakly similar at the N-terminus to Q8XCD1 Hypothetical protein z2967 from Escherichia coli O157:H7 (115 aa), fasta scores: opt: 148, E(): 0.037, (29.167% identity in 96 aa overlap). Has signal peptide and appropriately positioned PS00013 Prokaryotic membrane lipoprotein lipid attachment site.

close this sectionSequence

selected fasta
>[possible lipoprotein]
MNLPTRRGRPRIHARTAIGSTVAALAMATVGCSSDSDVVATSMAPSSSSTGVSARQSTTA
SVPAQDRPTGYVSRKTWTDGPWPLIIDEAVLDCQGDSLVTITANESTYALNSAAYSQTEL
PDYAPAIGAHDPDKPGSYLDAGPLIERGLALCGTPATTSTPISGSNRPAGLVERKTWTDG
RWPFTVDSATLFCTKPAGPQSERVTVVANHEMYALNGTAQDANLWPAFDPIWRDDPIAPG
MKINIGPMIERGLALCEG
selected fasta
>[possible lipoprotein]
GTGAACCTTCCTACCCGACGTGGACGACCAAGGATCCATGCGCGCACTGCAATTGGGTCG
ACCGTGGCTGCACTGGCTATGGCGACAGTCGGTTGCAGCTCGGACAGTGATGTCGTGGCG
ACTTCGATGGCGCCTTCCTCGAGCAGCACAGGAGTGTCGGCGCGGCAATCAACGACTGCC
TCCGTCCCGGCACAGGATCGCCCCACGGGATACGTCAGCCGAAAGACATGGACCGACGGC
CCCTGGCCGCTGATCATCGATGAAGCTGTACTCGACTGCCAGGGTGACAGTCTTGTCACC
ATCACCGCGAACGAATCTACCTATGCCCTCAACTCGGCAGCGTATTCGCAAACTGAACTA
CCCGACTACGCCCCCGCGATCGGGGCTCACGACCCCGACAAACCGGGCTCCTATCTTGAT
GCTGGGCCCTTGATTGAGCGAGGGCTGGCACTGTGCGGCACCCCTGCGACGACCTCAACA
CCGATCAGCGGCTCAAACCGTCCCGCGGGCCTGGTTGAACGCAAAACATGGACCGATGGT
CGGTGGCCGTTCACCGTCGACTCCGCCACCCTCTTTTGCACCAAACCGGCCGGCCCCCAA
AGTGAACGAGTGACGGTCGTCGCCAACCACGAGATGTACGCCCTAAATGGGACCGCCCAG
GACGCAAACCTCTGGCCGGCCTTCGACCCGATCTGGCGCGACGACCCCATAGCTCCGGGG
ATGAAGATCAATATCGGACCCATGATTGAGCGCGGACTTGCGCTGTGCGAAGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019648 Protein of unknown function DUF2511 (Family)
 [75-152]  1.7e-08 PF10709 [177-256]  5.40000000000001e-14 PF10709
PF10709   DUF2511
SignalP
 [1-54]  1 Signal
Bacteria, Gram-positive   
 [1-34]  0.984 Signal
Bacteria, Gram-negative   
 [1-34]  0.89 Signal
Eukaryota   
TMHMM No significant hit