close all open/close all

CDS information : MUP_00580


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction153,351 / 152,314 / - [in whole cluster]
153,351 / 152,314 / - [in contig]
Locationcomplement(152314..153351) [in whole cluster]
complement(152314..153351) [in contig]
TypeCDS
Length1,038 bp (345 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)possible site-specific recombinase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP058c, -, len: 345 aa. Possible site-specific recombinase, weakly similar to several e.g. Q8U9U6 Site-specific recombinase from Agrobacterium tumefaciens (strain C58 / ATCC 33970) (331 aa), fasta scores: opt: 278, E(): 1.6e-11, (26.441% identity in 295 aa overlap)Q9JW14 Putative integrase/recombinase from Neisseria meningitidis (serogroup A) (305 aa), fasta scores: opt: 271, E(): 4.6e-11, (28.808% identity in 302 aa overlap); and O31206 Site-specific recombinase from Proteus mirabilis (313 aa), fasta scores: opt: 258, E(): 3.7e-10 (31.010% identity in 287 aa overlap). Contains Pfam match entries to PF02899 Phage integrase and PF00589 Phage integrase family.

close this sectionSequence

selected fasta
>[possible site-specific recombinase]
MLETNSRDASPALVHPGWFGEFLADRAIRKPSPHTTKAYRQDFEAVALLLAGGADAISTL
PTNALNKESLRAAFAVYAETHSAASIRRCWSTWNTLCTFLYTANLLDANPMPAIGRPKVP
KALPKSYTADAVNNLIAAIDTDDGSARRSNWPERDRAIIFTALLTGLRADELIRANIGDI
RCNADGGVLHVSGKGNKDRRIPCDTKLIEMLQRYLQTREDRIPHLRKRSASPDVMGRFSP
TAPLFVGSDGERITRGTLQYRILRGFKKAGINNDRAAGALVHGLRHTFATELANANVSVY
ALMKLLGHESMVTSQRYVDGAAADTRRAAERNPLYSLLNIETESQ
selected fasta
>[possible site-specific recombinase]
GTGCTCGAAACCAACTCGCGAGATGCGTCACCTGCACTGGTCCACCCGGGTTGGTTCGGT
GAATTCCTCGCTGACAGGGCGATCCGCAAGCCGTCGCCGCATACAACCAAGGCATACCGT
CAAGATTTCGAGGCCGTAGCCCTACTGCTCGCCGGTGGCGCTGATGCCATTTCGACCCTT
CCGACGAACGCGTTGAACAAAGAATCCCTACGCGCTGCGTTCGCGGTATACGCCGAGACG
CACTCGGCGGCCTCCATCCGCCGCTGTTGGTCAACATGGAACACCCTTTGCACGTTCCTA
TACACCGCTAATCTCCTCGACGCCAACCCAATGCCAGCCATTGGGCGCCCCAAAGTGCCC
AAGGCCCTGCCGAAGAGCTACACGGCCGACGCAGTCAATAACCTGATCGCCGCCATCGAC
ACCGACGACGGATCTGCCCGCCGCAGCAACTGGCCCGAGCGTGACCGCGCAATCATTTTC
ACCGCTCTACTAACGGGCCTACGAGCCGACGAACTCATCAGAGCAAACATCGGCGACATC
CGTTGCAACGCCGACGGTGGTGTGCTACACGTCAGCGGAAAAGGCAACAAAGACCGCCGA
ATTCCCTGTGATACAAAGCTTATCGAGATGCTCCAACGCTATCTGCAGACTCGCGAAGAC
CGTATTCCGCACTTGCGCAAGCGATCAGCGAGCCCAGACGTCATGGGTAGATTTTCCCCG
ACCGCTCCCCTATTCGTGGGTTCCGACGGAGAACGCATCACCCGCGGCACACTGCAGTAC
CGAATTCTAAGAGGTTTCAAGAAGGCCGGAATCAACAACGACCGAGCCGCCGGAGCCCTG
GTCCACGGCCTACGCCACACCTTCGCCACCGAACTGGCCAACGCCAACGTCAGCGTCTAC
GCACTCATGAAACTTCTCGGCCACGAATCGATGGTCACCTCCCAACGCTACGTCGACGGC
GCAGCCGCCGACACCCGGCGCGCCGCAGAGCGCAACCCCCTCTACTCCCTGCTCAACATC
GAGACAGAAAGCCAATAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002104 Integrase, catalytic (Domain)
 [128-319]  9.8e-27 PF00589
PF00589   Phage_integrase
IPR011010 DNA breaking-rejoining enzyme, catalytic core (Domain)
 [120-333]  2.80000504261099e-39 SSF56349
SSF56349   DNA_brk_join_enz
IPR013762 Integrase-like, catalytic core (Domain)
 [127-329]  1.40000000000001e-40 G3DSA:1.10.443.10
G3DSA:1.10.443.10   Phage_intgr_like
IPR023109 Integrase/recombinase, N-terminal (Domain)
 [26-112]  6.40000000000001e-10 G3DSA:1.10.150.130
G3DSA:1.10.150.130   Integrase_recombinase_N
SignalP No significant hit
TMHMM No significant hit