close all open/close all

CDS information : MUP_00590


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction154,641 / 153,595 / - [in whole cluster]
154,641 / 153,595 / - [in contig]
Locationcomplement(153595..154641) [in whole cluster]
complement(153595..154641) [in contig]
TypeCDS
Length1,047 bp (348 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)probable transposase for the insertion element IS2404
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP059c, -, len: 348 aa. Probable transposase for IS2404, highly similar to O07439 Putative transposase from Mycobacterium ulcerans (327 aa), fasta scores: opt: 1839, E(): 2.4e-119, (92.949% identity in 312 aa overlap).

close this sectionSequence

selected fasta
>[probable transposase for the insertion element IS2404]
MALLAIAVLATAAGMRGYAGFATWAATASDDVLAQLGVRFRRPSEKIFRAVLSRLDPADL
NARMGSYFTAHVASSDPSGLVPIALDGKMLRGALRAKATATHLVSVFAHRARLVLGQLAV
AEKSNEIPCVCALLTLLPDNLRWLVTVDAMHTQVVTAKLICATLKSHYLMIVKSNQAKIL
ARITALPWAEVPAAATDDSRGHGRVETRTLQIITAARGIGFPYAKQIIRITRERLITATD
QRSVEVVYAICSLPFEHARPTAIMTWMRQHCGIENSLHWIRDVTFDEDRHRAHTGNGAQV
LATLRNTAINLHRLNGADNIAEACRITALTANRRLDLLNPQFPSSQAC
selected fasta
>[probable transposase for the insertion element IS2404]
ATGGCTTTGTTGGCGATCGCGGTTCTGGCCACTGCCGCGGGGATGCGCGGCTATGCTGGT
TTTGCCACATGGGCGGCCACCGCTTCCGATGATGTGTTGGCCCAATTAGGGGTCCGGTTC
CGGCGGCCCAGTGAGAAGATCTTCCGCGCTGTTTTGTCTCGGCTAGACCCCGCCGACCTC
AACGCCAGGATGGGCAGTTACTTCACTGCACACGTGGCCAGCAGCGACCCCAGTGGATTG
GTGCCGATCGCGTTGGACGGCAAGATGCTGCGTGGTGCTTTACGCGCCAAAGCGACAGCC
ACGCATCTCGTGTCGGTGTTCGCCCACCGTGCCCGATTGGTGCTCGGTCAACTCGCTGTC
GCCGAGAAAAGCAATGAAATTCCCTGCGTATGTGCCCTGCTCACGCTGCTGCCGGATAAC
TTGCGGTGGCTGGTCACCGTGGATGCGATGCATACCCAGGTCGTCACCGCGAAGTTGATC
TGCGCCACCTTGAAGTCGCACTACCTGATGATCGTCAAGTCCAACCAAGCCAAAATACTT
GCCCGTATCACCGCGCTGCCCTGGGCCGAGGTGCCCGCAGCCGCTACCGACGACTCCCGC
GGCCACGGCCGTGTCGAGACCCGCACCCTGCAAATCATCACCGCTGCACGAGGAATCGGC
TTCCCCTACGCAAAACAAATCATCCGGATCACTCGTGAACGCTTGATCACCGCCACCGAC
CAGCGCAGCGTGGAGGTGGTCTATGCCATCTGCAGCCTGCCGTTCGAGCACGCCCGCCCT
ACCGCGATCATGACCTGGATGCGTCAACACTGCGGAATCGAGAACAGCCTGCACTGGATA
CGCGACGTCACCTTCGACGAAGACCGTCACAGGGCACATACCGGAAACGGCGCACAGGTC
CTAGCAACGCTACGCAACACCGCGATCAATCTGCACCGCCTCAACGGCGCCGACAACATC
GCCGAAGCCTGCCGGATCACCGCTTTGACCGCCAACCGCCGCCTAGACCTCCTCAATCCA
CAATTCCCCAGCTCACAAGCCTGCTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002559 Transposase, IS4-like (Domain)
 [81-311]  6.40000000000001e-20 PF01609
PF01609   DDE_Tnp_1
SignalP
 [1-21]  0.397 Signal
Bacteria, Gram-positive   
 [1-19]  0.998 Signal
Eukaryota   
 [1-25]  0.991 Signal
Bacteria, Gram-negative   
TMHMM No significant hit