close all open/close all

CDS information : MUP_00600


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction155,147 / 155,668 / + [in whole cluster]
155,147 / 155,668 / + [in contig]
Location155147..155668 [in whole cluster]
155147..155668 [in contig]
TypeCDS
Length522 bp (173 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)probable transposase for the insertion element IS2606 (fragment)
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP060, -, len: 173 aa. Probable IS2606 transposase fragment, highly similar to the N-terminus of Q9ZG97 Probable transposase from Mycobacterium ulcerans (444 aa), fasta scores: opt: 886, E(): 1.8e-52, (84.615% identity in 169 aa overlap); and to the N-terminus of O05912 Hypothetical 48.7 kDa protein (IS1554, transposase) from M. tuberculosis (439 aa), fasta scores: opt: 506, E(): 1.1e-26, (60.000% identity in 135 aa overlap). The transposase described here may be made by a frame shifting mechanism during translation that fuses MUP060 and MUP061, no sequence errors have been identified to account for this.

close this sectionSequence

selected fasta
>[probable transposase for the insertion element IS2606 (fragment)]
MMTKTVVAVQPSQNHEDEAGAVAAIDVPSSRDVDELEVARELVRQAREAGVGLTGPGGLL
KAMTKTVIEIALDEELSEHLGYDRHDRAGYGSGNSRNGTRSKTVLTDGCGFIEIDVPRDR
AGTFEPKIVEKRQRRLTDVDEVGVVAVCPRVDHRGDQRPFRPHLRRGGVQGHR
selected fasta
>[probable transposase for the insertion element IS2606 (fragment)]
ATGATGACCAAGACTGTCGTGGCTGTGCAGCCATCACAAAACCACGAAGATGAGGCCGGC
GCCGTGGCGGCTATTGACGTTCCCAGTAGTCGCGATGTTGATGAGTTAGAAGTCGCCCGC
GAGTTGGTGCGCCAGGCCCGCGAGGCCGGCGTTGGGTTAACCGGGCCTGGCGGATTGCTC
AAGGCGATGACCAAAACGGTCATTGAGATCGCTTTGGATGAGGAACTGTCCGAGCACCTT
GGATATGACCGCCACGATCGGGCTGGGTATGGCAGTGGCAACTCGCGCAACGGAACCCGC
TCGAAAACGGTGCTCACTGATGGGTGCGGTTTCATTGAGATCGATGTCCCACGGGATCGG
GCAGGCACATTCGAGCCGAAGATCGTCGAAAAACGCCAGCGTAGGTTGACCGACGTCGAT
GAGGTGGGTGTTGTCGCTGTATGCCCGCGGGTTGACCACCGGGGAGATCAGCGCCCATTT
CGCCCACATCTACGACGCGGCGGTGTCCAAGGACACCGTTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001207 Transposase, mutator type (Family)
 [52-142]  2.4e-22 PF00872
PF00872   Transposase_mut
SignalP No significant hit
TMHMM No significant hit