close all open/close all

CDS information : MUP_00610


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction155,574 / 156,482 / + [in whole cluster]
155,574 / 156,482 / + [in contig]
Location155574..156482 [in whole cluster]
155574..156482 [in contig]
TypeCDS
Length909 bp (302 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)probable transposase for the insertion element IS2606 (fragment)
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP061, -, len: 302 aa. Probable IS2606 transposase fragment, highly similar to the C-terminus of Q9ZG97 Probable transposase from Mycobacterium ulcerans (444 aa), fasta scores: opt: 1990, E(): 2.8e-132, (98.675% identity in 302 aa overlap); and to the C-terminus of O05912 Hypothetical 48.7 kDa protein (IS1554, transposase) from M. tuberculosis (439 aa), fasta scores: opt: 1544, E(): 6.9e-101, (75.166% identity in 302 aa overlap). The transposase described here may be made by a frame shifting mechanism during translation that fuses MUP060 and MUP061, no sequence errors have been identified to account for this.

close this sectionSequence

selected fasta
>[probable transposase for the insertion element IS2606 (fragment)]
MLSLYARGLTTGEISAHFAHIYDAAVSKDTVSRITDCVLEEMTAWHTRPLERVYAAVFID
ALHVKIRDGQVGPRPVYAAVGVDLAGHRDVLGMWAGEGDGESAKYWLAVLTELKNRGVAD
IFFLVCDGLKGLPDSVSAVFPDTVVQTCIIHLIRGTFRYAGRQHHTAIARALKPIYTAVN
AAAAAEALDAFDTEWGHRYPAAIRLWRNAWNEFIPFLDYDTEIRKVICSTNAIEWLNARY
RRAIRARGHFPTEQSALKCLYLVTRSLDPTGTGQKRWTMRWKPALNAFAITFADRMPGSE
TT
selected fasta
>[probable transposase for the insertion element IS2606 (fragment)]
GTGTTGTCGCTGTATGCCCGCGGGTTGACCACCGGGGAGATCAGCGCCCATTTCGCCCAC
ATCTACGACGCGGCGGTGTCCAAGGACACCGTTAGCCGGATCACCGACTGCGTTCTCGAG
GAGATGACCGCCTGGCATACCCGCCCGCTAGAGCGCGTATACGCCGCGGTGTTCATCGAC
GCCCTGCACGTCAAGATCCGCGACGGCCAAGTCGGCCCCCGGCCGGTCTACGCCGCGGTC
GGGGTCGATCTGGCCGGACACCGTGACGTGCTGGGCATGTGGGCCGGTGAAGGTGACGGC
GAATCGGCCAAGTACTGGCTGGCAGTGCTGACGGAGTTGAAAAACCGCGGCGTGGCCGAC
ATCTTCTTCCTGGTCTGTGACGGCCTCAAAGGACTGCCGGACTCGGTGAGCGCGGTCTTC
CCCGACACCGTGGTGCAAACCTGCATCATCCACTTGATCCGCGGCACGTTCCGCTACGCC
GGGCGCCAGCACCACACCGCGATCGCCCGGGCGCTCAAGCCGATCTACACCGCGGTCAAC
GCTGCTGCGGCCGCCGAAGCCTTAGATGCCTTCGACACCGAATGGGGACACCGCTACCCA
GCGGCAATTCGATTGTGGCGCAACGCCTGGAATGAGTTCATCCCATTCCTGGACTACGAC
ACCGAGATAAGGAAGGTGATTTGTTCGACCAATGCCATTGAATGGCTCAACGCCCGCTAC
CGCCGTGCGATCAGGGCGCGTGGTCATTTCCCCACCGAGCAGTCCGCCCTGAAATGCCTA
TACTTGGTCACCCGGTCGCTAGATCCAACCGGAACCGGACAGAAGCGATGGACGATGCGC
TGGAAACCAGCATTGAACGCCTTCGCGATCACCTTCGCCGACCGCATGCCAGGAAGCGAA
ACCACCTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001207 Transposase, mutator type (Family)
 [1-268]  1e-94 PF00872
PF00872   Transposase_mut
 [127-151]  PS01007
PS01007   TRANSPOSASE_MUTATOR
SignalP No significant hit
TMHMM No significant hit