close all open/close all

CDS information : MUP_00640


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction158,251 / 157,889 / - [in whole cluster]
158,251 / 157,889 / - [in contig]
Locationcomplement(157889..158251) [in whole cluster]
complement(157889..158251) [in contig]
TypeCDS
Length363 bp (120 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)possible conserved membrane protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP064c, -, len: 120 aa. Possible conserved membrane protein, shows some similarity with other putative membrane proteins e.g. C-terminus of O06345|Rv3482c Probable conserved membrane protein from M. tuberculosis (260 aa), fasta scores: opt: 129, E(): 0.39, (30.233% identity in 86 aa overlap). And show some similarity to Mycobacteriophage proteins e.g. AAN12600 Gp39 from Mycobacteriophage (132 aa), fasta score: E(): 0.055, (40.000% identity in 50 aa overlap). Contains several membrane spanning regions towards the C-terminus.

close this sectionSequence

selected fasta
>[possible conserved membrane protein]
MTTPPPPPGWYPDPSDPEKRIYWDGAAWSRPASAATEVDKANKSKKTAITIGVCVLVVIG
LVMSMQSVSLMTGSGPVWTGVAVVAAGTAIAFFLRAARWVRVVAALILALALANAGLRRC
selected fasta
>[possible conserved membrane protein]
GTGACCACGCCCCCACCTCCGCCAGGTTGGTATCCAGACCCATCGGATCCTGAAAAACGA
ATCTACTGGGACGGCGCCGCTTGGAGCAGGCCAGCATCCGCGGCGACCGAAGTCGACAAG
GCAAACAAGAGCAAGAAGACGGCGATTACGATTGGCGTCTGCGTACTTGTTGTCATCGGA
CTTGTCATGTCAATGCAGTCAGTCAGCCTCATGACAGGCTCAGGCCCGGTGTGGACCGGC
GTTGCCGTCGTAGCAGCTGGCACGGCAATTGCATTCTTTTTACGCGCTGCCAGGTGGGTC
CGCGTCGTCGCTGCCTTGATCCTGGCGCTTGCACTCGCAAACGCAGGGCTCCGGCGTTGT
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR018929 Domain of unknown function DUF2510 (Domain)
 [8-38]  5e-11 PF10708
PF10708   DUF2510
SignalP
 [1-1]  Signal-anchor
Eukaryota   
 [1-34]  0.332 Signal
Bacteria, Gram-negative   
TMHMM
 [48-70]  Transmembrane (o-i) [77-94]  Transmembrane (i-o) [99-117]  Transmembrane (o-i)
Transmembrane 3