close all open/close all

CDS information : MUP_00650


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction159,352 / 158,471 / - [in whole cluster]
159,352 / 158,471 / - [in contig]
Locationcomplement(158471..159352) [in whole cluster]
complement(158471..159352) [in contig]
TypeCDS
Length882 bp (293 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)conserved hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP065c, -, len: 293 aa. Conserved hypothetical protein, weakly similar at the N-terminus to several hypothetical proteins e.g. Q8U687 Hypothetical protein Atu6048 from Agrobacterium tumefaciens (strain C58 / ATCC 33970) (836 aa), fasta scores: opt: 223, E(): 8.2e-07, (30.000% identity in 170 aa overlap); and also some similarity at the N-terminus to several helicases e.g. AAO50170 Putative helicase from Streptomyces violaceoruber (866 aa), fasta scores: E(): 1.1e-09, (33.032% identity in 221 aa overlap); and P44701|SRMB_HAEIN ATP-dependent RNA helicase srmB homolog from Haemophilus influenzae (439 aa), fasta scores: opt: 124, E(): 1.9, (31.429% identity in 105 aa overlap). Contains a Pfam match to entry PF00270, DEAD/DEAD box helicase.

close this sectionSequence

selected fasta
>[conserved hypothetical protein]
MYLRGGLRRTGDAVSSLWIHQGDVLRAYAQKHQDTADIALELPTGTGKTLPGLLIAEWVR
RKAAGPVLYATPTKQLARQVLATAHAEGVPARLLVGSHLHWNVTDHSDVDGGEAIAITTY
SSIFNSSPKLPVPNLIVFDDAHAGEQFVGEHYSVEIRRYEDEPAYLAVLDALRPFMSGLQ
IQRLQGVPDPGAHHQVRLILPAVKPGAPARLDTTLSNLGDSYKFDFAMIWYHASTKPSPF
CGNPSNRRLVLLPFSWIIFIIHEKALGIDRSPGEPRPLAAWATTRRDASQARG
selected fasta
>[conserved hypothetical protein]
ATGTACCTACGCGGTGGACTGCGCCGCACTGGGGATGCCGTCAGCTCGCTGTGGATTCAC
CAAGGCGACGTGCTTCGAGCGTACGCCCAGAAACATCAAGACACTGCCGACATCGCGTTG
GAATTGCCGACCGGTACGGGCAAGACGTTGCCCGGTCTGCTGATCGCTGAATGGGTTCGG
CGCAAGGCGGCTGGTCCGGTGCTCTATGCCACGCCGACCAAGCAACTCGCCCGCCAGGTG
CTGGCCACGGCGCACGCTGAGGGCGTACCTGCACGTCTATTGGTCGGCAGCCACCTTCAC
TGGAACGTCACCGACCATAGTGACGTTGATGGTGGTGAGGCGATCGCCATCACGACCTAC
AGCTCGATCTTCAACAGCAGCCCGAAGTTGCCTGTGCCGAATCTAATAGTGTTCGACGAC
GCTCACGCTGGTGAGCAATTCGTCGGTGAGCACTACAGCGTCGAAATCCGCCGCTACGAG
GACGAGCCAGCGTATCTTGCCGTCCTCGATGCACTGCGCCCGTTTATGTCAGGTCTGCAG
ATTCAGCGGCTCCAGGGGGTGCCGGACCCGGGCGCACATCACCAGGTGCGTCTCATCCTG
CCCGCCGTCAAACCCGGCGCTCCGGCAAGACTCGACACAACGTTGTCGAACCTCGGGGAC
TCGTACAAGTTCGACTTCGCCATGATCTGGTACCACGCGTCCACCAAGCCGTCCCCCTTT
TGCGGAAACCCGTCAAACAGGCGGCTGGTCCTCCTACCCTTTTCATGGATAATCTTCATT
ATCCATGAAAAAGCACTGGGCATTGACCGATCTCCAGGCGAACCAAGACCGTTGGCGGCT
TGGGCTACCACTCGGCGAGACGCTTCCCAGGCTCGTGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011545 DNA/RNA helicase, DEAD/DEAH box type, N-terminal (Domain)
 [35-146]  2e-06 PF00270
PF00270   DEAD
IPR014001 Helicase, superfamily 1/2, ATP-binding domain (Domain)
 [29-191]  PS51192
PS51192   HELICASE_ATP_BIND_1
SignalP
 [1-29]  0.133 Signal
Eukaryota   
 [1-29]  0.149 Signal
Bacteria, Gram-negative   
TMHMM No significant hit