close all open/close all

CDS information : MUP_00660


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction160,330 / 159,824 / - [in whole cluster]
160,330 / 159,824 / - [in contig]
Locationcomplement(159824..160330) [in whole cluster]
complement(159824..160330) [in contig]
TypeCDS
Length507 bp (168 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)conserved hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP066c, -, len: 168 aa. Conserved hypothetical protein, weakly similar to several bacteriophage-related proteins e.g. P03796|Y77_BPT7 Hypothetical gene 7.7 protein from Bacteriophage T7 (130 aa), fasta scores: opt: 171, E(): 0.0002, (32.075% identity in 106 aa overlap); and Q8XUF2 Putative bacteriophage-related protein from Ralstonia solanacearum (Pseudomonas solanacearum) (183 aa), fasta scores: opt: 163, E(): 0.00089, (32.773% identity in 119 aa overlap). Contains a Prosite match to entry PS00029 LEUCINE_ZIPPER Leucine zipper pattern.

close this sectionSequence

selected fasta
>[conserved hypothetical protein]
MPTAVGIALWVDPVLHANESRRFDSFVVRGHYERDCDFFTGAIGTDGYGRFYISRGKELC
VRPHRYALARSRGALRSHELALHECDNPLCVKISDASASSQHVVVGTQADNMRRMARMRR
GGGRKPIAGDGLRVRRERSVALRAVLRERGWDRDAVEAALLGDMPTLW
selected fasta
>[conserved hypothetical protein]
GTGCCAACCGCTGTAGGAATCGCGTTGTGGGTTGATCCGGTCTTGCACGCCAACGAATCT
CGGCGTTTCGACTCCTTCGTCGTTAGAGGCCACTATGAGCGTGACTGTGACTTCTTTACC
GGGGCAATCGGGACGGACGGTTATGGTCGCTTCTACATTTCACGAGGCAAAGAGCTATGC
GTGCGACCACATCGATACGCATTGGCCCGTTCCCGAGGAGCGCTTCGCAGTCACGAACTG
GCACTGCACGAATGCGACAATCCGCTGTGCGTCAAGATAAGTGATGCCAGTGCATCATCA
CAGCACGTCGTTGTCGGTACTCAGGCAGACAACATGCGGCGAATGGCGCGGATGCGCCGA
GGCGGTGGCCGCAAGCCGATTGCCGGCGATGGTCTGAGGGTCCGCCGCGAGCGCTCGGTC
GCGTTGCGAGCAGTCTTGCGTGAACGCGGCTGGGATCGCGACGCTGTTGAGGCGGCACTG
CTAGGGGATATGCCGACGCTGTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-17]  0.569 Signal
Eukaryota   
 [1-17]  0.151 Signal
Bacteria, Gram-negative   
TMHMM No significant hit