close all open/close all

CDS information : MUP_00670


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction161,049 / 160,417 / - [in whole cluster]
161,049 / 160,417 / - [in contig]
Locationcomplement(160417..161049) [in whole cluster]
complement(160417..161049) [in contig]
TypeCDS
Length633 bp (210 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)conserved hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP067c, -, len: 210 aa. Conserved hypothetical protein, weak similarity to N-terminus of spermidine synthases e.g. Q82EU4 Putative spermidine synthase from Streptomyces avermitilis (548 aa), FASTA scores: opt: 124, E(): 2.5, (34.091% identity in 88 aa overlap); and weak similarity to N-terminus of O87639|SCO3941 Putative serine/threonine phosphatase from Streptomyces coelicolor (368 aa), fasta scores: opt: 112, E(): 12, (27.919% identity in 197 aa overlap).

close this sectionSequence

selected fasta
>[conserved hypothetical protein]
MYPGCVAPGLPQRPSPPARSKPSAWVHHCQPACRVGNEVQRSLPGVELFAACGRVSQRQF
DIDVIDYASTVVAGGVNGASLSGQQFYAGVGSAAVAGVDASSIAAAQLARFALFSVVNVD
VGQRQWLRQSHFGDRVGQCVVGGMSGAADAALRLGEHVVALPRRSRRGYGGDHLLGLGCD
PFVIDAFDLASRPGKDRASATDTVQRSHAG
selected fasta
>[conserved hypothetical protein]
ATGTACCCCGGCTGTGTAGCTCCTGGCCTACCGCAGCGTCCATCGCCGCCGGCGAGGTCC
AAACCATCCGCATGGGTCCACCACTGTCAACCTGCTTGTCGTGTTGGCAATGAGGTCCAG
CGCAGCTTGCCCGGCGTTGAGCTGTTTGCCGCGTGCGGCCGAGTCAGCCAGCGCCAATTC
GACATCGACGTCATCGACTACGCGTCCACCGTGGTGGCGGGCGGCGTCAATGGTGCGTCG
CTCAGCGGCCAGCAGTTCTACGCTGGTGTAGGTAGTGCTGCCGTGGCGGGTGTAGACGCT
AGTTCCATCGCGGCGGCGCAGTTGGCGCGGTTCGCCCTTTTCTCCGTCGTCAACGTTGAT
GTGGGCCAGCGACAATGGCTGCGCCAAAGCCACTTCGGTGATCGTGTCGGCCAGTGTGTC
GTTGGCGGCATGTCCGGTGCCGCGGATGCAGCGCTGCGCCTCGGCGAGCACGTGGTGGCG
TTGCCACGTCGCTCGCGACGCGGCTACGGTGGCGATCACTTGCTGGGCTTGGGCTGCGAT
CCATTCGTCATCGACGCGTTCGATCTGGCGAGCCGGCCTGGAAAGGACCGCGCGTCAGCT
ACTGACACTGTTCAGCGCAGCCATGCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-20]  0.163 Signal
Bacteria, Gram-negative   
TMHMM No significant hit