close all open/close all

CDS information : MUP_00680


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction162,215 / 161,085 / - [in whole cluster]
162,215 / 161,085 / - [in contig]
Locationcomplement(161085..162215) [in whole cluster]
complement(161085..162215) [in contig]
TypeCDS
Length1,131 bp (376 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)conserved membrane protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP068c, -, len: 376 aa. Conserved membrane protein, similar to several Mycobacterial membrane proteins e.g. O53933|Rv1782 (506 aa) from M. tuberculosis, fasta scores: opt: 763, E(): 1.8e-34, (41.935% identity in 341 aa overlap); Q9Z5I3 Hypothetical 53.9 kDa protein (Conserved membrane protein) from M. leprae (506 aa), fasta scores: opt: 733, E(): 4.2e-32, (38.596% identity in 399 aa overlap); and the M. tuberculosis proteins Rv3895c, Rv0283, Rv3869 and Rv3450c. And also weakly similar to other bacterial hypothetical proteins e.g. Q8NSU6 Hypothetical protein Cgl0571 from Corynebacterium glutamicum (419 aa), fasta scores: opt: 349, E(): 4.3e-12, (31.818% identity in 242 aa overlap). Contains a Pfam match to entry PF05108 DUF690, protein of unknown function and a Prosite match to entry PS50310 alanine-rich region. Contains a possible N-terminal signal sequence.

close this sectionSequence

selected fasta
>[conserved membrane protein]
MPLKLASKTQVSGHFFVRRRLAFALLRRSVSMEINPVRWHRTLLVLSAVLGVVLVVGAFV
YGWFRPAGTIDASSKIVTDRSSGALFVVVGGRLHPALNLMSAQLIAGSPDRPTFVSSAQI
AEWPKGPAVGIAGAPVQTPTVLSPQVSRWAVCDAAAETLRGVPVVTGIDGQLALGQGAAE
LGGAEALLLSYGQQVYVVANGVRMPVDVSEPALAGPLGISAGAAPTAMSEALFDALPAGD
RLVVPVVSGAGGAPGVDLGPRVVVGAVVASRDVAADTDRFYVVLADGVQEISPVVASMLR
QHDSFGLPTPPRVSPDRLAKVPRPIGTTAPIAGAPPARVAAVAAPPALSAAACAASAGDS
TNIIGQSLTLSETHPV
selected fasta
>[conserved membrane protein]
GTGCCGTTGAAGTTGGCGTCGAAGACGCAGGTTTCGGGTCATTTTTTTGTGCGGCGCCGG
CTGGCGTTTGCGCTGCTGCGTCGCTCGGTGAGTATGGAGATCAATCCGGTTCGTTGGCAT
CGCACGTTGCTGGTGTTGTCGGCGGTTTTGGGTGTGGTCTTGGTGGTGGGGGCGTTTGTG
TATGGGTGGTTCCGGCCGGCGGGGACCATCGATGCTTCGTCGAAGATTGTTACTGACCGG
TCATCGGGTGCGTTGTTTGTCGTTGTTGGTGGGCGGCTACACCCGGCGTTGAACTTGATG
TCAGCGCAGTTGATTGCTGGTTCGCCGGATCGACCGACGTTTGTGTCGTCGGCGCAGATC
GCCGAGTGGCCTAAGGGGCCGGCGGTCGGGATTGCCGGTGCTCCGGTGCAGACGCCGACG
GTGTTATCGCCGCAGGTGTCGCGGTGGGCTGTGTGCGATGCGGCGGCTGAGACTCTTCGT
GGGGTTCCGGTGGTGACCGGCATTGATGGGCAGCTGGCGTTGGGGCAGGGAGCTGCGGAG
CTCGGTGGGGCTGAGGCGCTGTTGTTGTCGTATGGGCAGCAGGTGTATGTGGTGGCCAAC
GGGGTTCGGATGCCGGTCGATGTGTCTGAGCCGGCGCTGGCTGGCCCGTTAGGGATTTCG
GCGGGCGCAGCGCCAACTGCTATGTCGGAGGCGTTGTTTGATGCGCTGCCGGCGGGGGAT
CGACTGGTTGTGCCGGTCGTCTCTGGCGCCGGTGGTGCTCCTGGGGTGGACCTTGGGCCG
CGGGTGGTGGTCGGGGCTGTGGTGGCTAGCCGTGATGTCGCTGCGGATACGGACCGGTTT
TATGTGGTGTTGGCTGATGGGGTGCAGGAGATTTCGCCGGTTGTGGCTTCGATGTTGCGC
CAACATGATTCGTTCGGCCTGCCGACGCCGCCGCGGGTGTCGCCGGATCGGTTGGCGAAG
GTCCCGAGACCCATCGGGACCACTGCGCCCATCGCCGGCGCGCCACCGGCAAGAGTTGCA
GCTGTGGCCGCCCCGCCCGCGCTTTCAGCCGCCGCTTGCGCTGCCAGTGCCGGTGACTCG
ACAAACATCATTGGACAATCCCTTACCTTGTCTGAGACCCACCCCGTGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007795 Type VII secretion system EccB (Family)
 [1-344]  2.50000000000001e-91 PF05108
PF05108   DUF690
 [7-360]  1.99999999999999e-105 TIGR03919
TIGR03919   T7SS_EccB
SignalP
 [1-1]  Signal-anchor
Eukaryota   
 [1-62]  0.938 Signal
Bacteria, Gram-positive   
TMHMM
 [42-64]  Transmembrane (i-o)
Transmembrane 1