close all open/close all

CDS information : MUP_00700


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction164,824 / 163,727 / - [in whole cluster]
164,824 / 163,727 / - [in contig]
Locationcomplement(163727..164824) [in whole cluster]
complement(163727..164824) [in contig]
TypeCDS
Length1,098 bp (365 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)conserved hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP070c, -, len: 365 aa. Conserved hypothetical protein, weakly similar to part of Q9KYC4 Hypothetical protein SCO6906 from Streptomyces coelicolor (529 aa), fasta scores: opt: 185, E(): 0.0015, (27.305% identity in 282 aa overlap). Similarity to Q9KYC4 begins in the upstream CDS, and this could be accounted for by a frameshift, although the sequence has been checked and no discrepancy was found.

close this sectionSequence

selected fasta
>[conserved hypothetical protein]
MSRYPRVSICVTSCSGPSTGANLIRRERKKDGFRDTLIWYTTQHIAVADRDCEIWLVSTN
HRDFGDKSQAVDHEACPYPLHPHLLEDLDTADLSGRVSYVRTLGRLVQHLAGKYDSQPES
QREALISQLNQDKFEIALAASVDRFRLNPAAAALPLKAAYGVVHAFDRDVGSLEFVDVAM
RGGGEWTAQFKQPIYATVDLTDRAAETSNVDKTLNVAGRLTVGANGHVRSMIVTSIEALP
DDPMLRAWRMAWDPMSDTGFAQNIRQQIDPLSNPNTAKRIHESPMRPPEPDEPQKLASPS
LDELAANDVASPSGEDSDPDENNGTTRDCRGKGVSGLIGPGVSGPERSHDDQDCRGCAAI
TKPRR
selected fasta
>[conserved hypothetical protein]
TTGTCCCGATACCCGAGGGTGTCAATCTGCGTGACATCGTGCAGCGGGCCATCGACCGGC
GCAAACCTTATCAGGAGGGAGAGGAAAAAAGACGGCTTTCGCGACACGCTGATTTGGTAT
ACGACACAACACATCGCGGTTGCGGATCGTGACTGTGAGATTTGGCTGGTCAGCACGAAT
CACCGCGATTTCGGCGACAAGTCACAAGCCGTTGATCACGAGGCGTGTCCGTACCCGCTT
CATCCCCATCTCCTCGAGGATCTTGACACGGCGGACCTATCTGGTCGAGTGTCCTACGTT
CGCACGTTGGGGCGCCTTGTACAACACCTTGCGGGCAAGTACGATTCGCAGCCTGAGTCA
CAGCGCGAAGCATTGATATCGCAGCTGAACCAGGACAAGTTTGAAATTGCACTTGCAGCC
TCAGTTGACCGATTCCGGCTGAACCCGGCAGCTGCTGCGTTGCCCCTGAAAGCTGCCTAC
GGGGTGGTCCACGCTTTCGATCGGGACGTCGGGAGCCTGGAGTTCGTCGACGTAGCCATG
CGCGGCGGTGGTGAGTGGACCGCCCAGTTCAAACAGCCTATCTACGCAACTGTTGATCTC
ACTGATCGTGCCGCGGAAACATCCAACGTGGACAAGACGCTCAATGTCGCGGGCCGACTG
ACTGTAGGCGCGAACGGCCACGTGAGGAGCATGATTGTCACGTCAATCGAGGCGTTGCCT
GATGACCCAATGCTGCGCGCGTGGCGCATGGCTTGGGACCCAATGTCGGACACCGGCTTC
GCCCAAAATATCCGCCAGCAGATCGACCCGCTGTCAAACCCAAACACTGCCAAAAGGATC
CACGAGAGCCCGATGCGGCCACCCGAACCCGACGAACCGCAGAAATTGGCTAGTCCGTCG
CTCGACGAGCTGGCCGCCAATGATGTCGCCTCACCGTCCGGCGAAGATTCCGACCCAGAC
GAGAACAACGGCACCACTCGGGACTGTCGCGGTAAGGGTGTAAGCGGCCTGATCGGCCCC
GGTGTGTCGGGGCCGGAAAGGTCGCATGATGACCAAGACTGTCGTGGCTGTGCAGCCATC
ACAAAACCACGAAGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-20]  0.922 Signal
Bacteria, Gram-negative   
 [1-20]  0.686 Signal
Eukaryota   
TMHMM No significant hit