close all open/close all

CDS information : MUP_00720


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction166,357 / 165,161 / - [in whole cluster]
166,357 / 165,161 / - [in contig]
Locationcomplement(165161..166357) [in whole cluster]
complement(165161..166357) [in contig]
TypeCDS
Length1,197 bp (398 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)conserved hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP072c, -, len: 398 aa. Conserved hypothetical protein, some similarity to proteins from Caenorhabditis elegans e.g. Q20739 F54B11.2 protein (304 aa), fasta scores: opt: 192, E(): 0.017, (39.216% identity in 102 aa overlap); and CAE11316 C. elegans COL-185 protein (305 aa), fasta scores: opt: 185, E(): 0.039, (38.235% identity in 102 aa overlap). Contains a Prosite match to entry PS50310 ALA_RICH Alanine-rich region.

close this sectionSequence

selected fasta
>[conserved hypothetical protein]
MTVTPAGAGVATGSGTAHAPAMMLPPPGLGAPAAPVAASGAAGGAAAVTPAGSSATPSGS
AGPAGPTGGSPAGSGAAMVVPASVVSAGTTNRSRAESPELAAAKELVRRLRRDSDMVNYA
CIEWAVGVFRSEANGTTECVAMSNEGFGYIPWGVFLPRTARLLAADKLADDQFRQRWFGA
ADPAEVMDEYARLRASRGAHLVAMAVTADSPFGPPPGVEHAVCGRDLAGDGYVRPTLDDM
GMHRLEATHPDLFARIQRLTGTEDQARLVENQVVLPLAMQMIDPVQTTSVQTPPELRQMW
NELGTGDSIGSDAWQKYNIAATVFFVNVSANRPGPDGEVAVREQYRGQWVAARAMELLQG
WERRPIATADMVYAAATAYPGDFAAKLERLLRGPEDGG
selected fasta
>[conserved hypothetical protein]
GTGACAGTGACGCCGGCTGGCGCCGGGGTCGCGACAGGATCCGGGACTGCTCACGCACCG
GCAATGATGCTTCCGCCGCCAGGGCTGGGTGCGCCGGCAGCCCCGGTAGCCGCCAGCGGC
GCTGCCGGCGGTGCGGCCGCGGTCACCCCTGCCGGCAGCTCGGCCACACCGAGCGGCTCT
GCAGGTCCCGCGGGACCCACGGGAGGCTCACCGGCGGGCTCCGGGGCCGCAATGGTCGTG
CCGGCAAGCGTCGTCAGCGCCGGGACCACCAACCGCAGCCGGGCCGAATCACCAGAGTTG
GCAGCGGCAAAAGAATTGGTGCGCAGGCTACGTCGTGATAGCGACATGGTCAACTATGCG
TGCATTGAATGGGCAGTCGGAGTGTTTCGCAGCGAGGCCAACGGAACGACAGAGTGTGTG
GCTATGTCCAACGAGGGCTTCGGCTACATCCCGTGGGGCGTATTCCTGCCGCGGACCGCG
CGCCTATTAGCTGCAGACAAACTCGCCGACGATCAGTTTCGGCAGCGGTGGTTCGGCGCG
GCCGACCCAGCAGAGGTCATGGACGAGTACGCACGGCTACGGGCCAGTCGGGGCGCACAT
CTGGTCGCGATGGCGGTGACCGCCGACAGCCCCTTCGGCCCGCCGCCGGGTGTCGAGCAT
GCGGTATGCGGGCGCGACTTGGCCGGTGACGGCTATGTGCGGCCAACACTCGACGACATG
GGCATGCATCGCCTCGAAGCCACCCACCCGGATCTGTTTGCCAGGATCCAGCGGTTAACT
GGCACAGAGGATCAAGCCCGGCTGGTCGAAAACCAGGTCGTGTTGCCGCTGGCAATGCAG
ATGATCGACCCTGTGCAGACTACGTCGGTCCAAACGCCACCTGAGTTGCGTCAGATGTGG
AATGAGCTGGGCACTGGCGACAGCATCGGCTCCGACGCCTGGCAAAAGTACAACATCGCT
GCAACGGTATTTTTTGTGAATGTGAGCGCTAACCGGCCTGGCCCGGATGGGGAAGTTGCA
GTGCGCGAACAGTACCGGGGGCAGTGGGTTGCCGCGCGGGCGATGGAGTTACTGCAGGGG
TGGGAGCGCCGTCCCATCGCGACGGCAGACATGGTCTACGCCGCTGCGACGGCGTATCCG
GGTGATTTCGCCGCCAAACTTGAACGCTTGCTGCGTGGTCCTGAGGACGGCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-55]  0.914 Signal
Eukaryota   
 [1-19]  0.644 Signal
Bacteria, Gram-negative   
 [1-38]  0.985 Signal
Bacteria, Gram-positive   
TMHMM No significant hit