close all open/close all

CDS information : MUP_00730


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction167,547 / 166,354 / - [in whole cluster]
167,547 / 166,354 / - [in contig]
Locationcomplement(166354..167547) [in whole cluster]
complement(166354..167547) [in contig]
TypeCDS
Length1,194 bp (397 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)conserved hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP073c, -, len: 397 aa. Conserved hypothetical protein. Some similarity to part of Q9Z5I9|IF2_MYCLE|ML1556 Translation initiation factor IF-2 from M. leprae (924 aa), fasta scores: opt: 228, E(): 0.0023, (26.997% identity in 363 aa overlap). Contains a Prosite match to entry PS00015 NUCLEAR Bipartite nuclear targeting sequence.

close this sectionSequence

selected fasta
>[conserved hypothetical protein]
MADVAAPSIAANVIITPDMVLPPAEPLEAQAAQYKTLADQVSDLAQQLRAANAMREDAAQ
SPGWDVGHEKNRQLAADYGCMAGIYTAAAQYFTGVAGVYRDAQRAQRSVVNRANQELSQA
KNAVQQQAIVARWHAHARALTTSAVGAATARATVFQETAGTDITALTSRLGGTPMPRDPV
LPHSGGSGIAVPPGKEKPLGLGDEPEPQEADPTGISNSNDASDAGVTHGHRPAGPREHVA
GTEGTATGSPMPTPALGTPFPPGATQLPAGGGSGVRSVGFPPGLSSPGGLGSMLGTGGSS
GGLGGLPASTGQLPGTQAAGLGGLPVSAPAAGGQAAQAAQLGRRFLEACRQGRGWDHYRR
QPESEPRQPHRRARRRRLDWPQAALRLRGWPRPARHR
selected fasta
>[conserved hypothetical protein]
ATGGCCGATGTGGCCGCACCGAGTATTGCCGCCAACGTCATCATTACACCCGATATGGTG
CTGCCGCCGGCAGAACCTCTCGAAGCCCAGGCCGCGCAGTACAAGACGCTCGCTGATCAA
GTCAGCGACCTCGCGCAGCAGCTTCGAGCTGCCAACGCGATGCGCGAGGATGCCGCACAG
TCGCCCGGTTGGGATGTGGGTCATGAAAAAAATCGCCAGCTCGCCGCCGACTACGGATGC
ATGGCCGGCATCTACACCGCTGCAGCGCAATACTTTACGGGGGTCGCTGGGGTCTACCGC
GACGCCCAAAGGGCCCAACGCAGCGTGGTTAACAGAGCAAATCAAGAGCTCTCGCAGGCA
AAAAACGCAGTCCAGCAGCAGGCGATCGTCGCGCGCTGGCACGCGCATGCGCGTGCCCTC
ACAACCAGCGCAGTCGGGGCAGCGACCGCTCGGGCCACAGTCTTCCAGGAAACTGCCGGT
ACCGATATTACGGCCCTAACCTCGCGGCTCGGTGGCACTCCAATGCCCCGCGACCCGGTC
TTACCGCACAGCGGGGGAAGCGGCATCGCCGTACCGCCAGGCAAGGAAAAGCCCCTCGGT
TTAGGTGATGAACCTGAACCACAGGAAGCCGATCCCACCGGCATCAGCAACAGCAACGAT
GCGTCTGACGCGGGAGTCACCCATGGCCACCGGCCGGCCGGTCCACGCGAGCATGTGGCA
GGCACGGAGGGAACCGCAACTGGCTCACCGATGCCCACTCCGGCGTTGGGAACGCCGTTC
CCGCCCGGGGCCACTCAACTCCCGGCAGGGGGTGGAAGTGGTGTGCGGTCAGTAGGTTTC
CCGCCCGGCTTGTCTTCCCCGGGTGGCCTGGGTTCGATGCTAGGGACCGGAGGATCATCC
GGTGGCCTGGGTGGGCTGCCGGCCAGCACCGGCCAGTTGCCTGGTACGCAGGCAGCGGGT
TTGGGAGGTCTGCCGGTGAGTGCGCCGGCAGCCGGTGGGCAGGCAGCCCAGGCCGCGCAG
TTGGGCCGGCGTTTTCTCGAGGCGTGTCGGCAGGGGCGGGGTTGGGATCACTACCGCCGT
CAACCGGAATCGGAACCCCGGCAGCCGCACAGACGGGCTCGGCGCCGGCGGCTGGATTGG
CCTCAGGCGGCGTTGCGCCTACGGGGGTGGCCGCGGCCGGCGCGACACCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-31]  0.16 Signal
Bacteria, Gram-negative   
 [1-31]  0.177 Signal
Bacteria, Gram-positive   
TMHMM No significant hit