close all open/close all

CDS information : MUP_00740


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction168,152 / 167,568 / - [in whole cluster]
168,152 / 167,568 / - [in contig]
Locationcomplement(167568..168152) [in whole cluster]
complement(167568..168152) [in contig]
TypeCDS
Length585 bp (194 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)possible membrane protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP074c, -, len: 194 aa. Possible membrane protein, weakly similar to several bacterial membrane and hypothetical proteins e.g. O53200|Rv2473 Hypothetical protein from M. tuberculosis (238 aa), fasta scores: opt: 155, E(): 0.18, (25.248% identity in 202 aa overlap); O86726 Hypothetical protein SCO6544 from Streptomyces coelicolor (226 aa), fasta scores: opt: 155, E(): 0.18, (25.405% identity in 185 aa overlap). Contains a Prosite match to entry PS50310 ALA_RICH Alanine-rich region. Contains hydrophobic region in the N-terminus.

close this sectionSequence

selected fasta
>[possible membrane protein]
MSVVLHPPHVPEAAGPPPVSPPPQLLRGVRPGRGIVWGSAAALLAAAVALVIAAMGWVAP
SGGAVSTVVVPWSPPSPSAAEVAAARTQACKLWGITASAMDDASNLVAHTPGDWNAPDMQ
EALANEARVIAVEGAYLRRALPDHTPAAIRSGIEDYLAASFDMENATTHRQGTSRNAAID
RANAAEDRVNAACR
selected fasta
>[possible membrane protein]
ATGAGCGTTGTTCTGCATCCCCCTCATGTGCCGGAAGCTGCTGGTCCGCCGCCGGTCTCG
CCGCCACCACAGCTGCTACGCGGGGTCCGCCCCGGCCGGGGGATCGTGTGGGGGTCAGCT
GCAGCCCTGCTGGCCGCCGCGGTTGCCCTGGTCATCGCCGCTATGGGTTGGGTTGCGCCG
TCCGGTGGGGCCGTCTCCACCGTGGTGGTGCCGTGGTCACCACCGTCACCGAGTGCCGCT
GAAGTCGCCGCTGCGCGTACGCAGGCGTGCAAGTTGTGGGGGATCACCGCTTCGGCGATG
GACGATGCCAGCAATCTGGTAGCCCACACGCCCGGCGATTGGAATGCTCCCGACATGCAG
GAGGCGTTGGCCAACGAGGCTCGGGTGATCGCGGTGGAAGGCGCCTACCTGCGTCGCGCA
TTGCCCGATCACACTCCAGCTGCGATCCGCTCGGGAATCGAAGACTATCTCGCGGCCAGC
TTTGATATGGAAAACGCCACTACCCACCGGCAGGGAACCTCGCGAAACGCTGCAATCGAT
CGGGCAAACGCCGCAGAGGACAGGGTCAACGCAGCCTGCCGCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-63]  0.571 Signal
Eukaryota   
TMHMM
 [35-57]  Transmembrane (i-o)
Transmembrane 1