close all open/close all

CDS information : MUP_00750


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction168,487 / 168,149 / - [in whole cluster]
168,487 / 168,149 / - [in contig]
Locationcomplement(168149..168487) [in whole cluster]
complement(168149..168487) [in contig]
TypeCDS
Length339 bp (112 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP075c, -, len: 112 aa. Hypothetical protein, some similarity to part of Q8Y3B8 Probable substrate-binding transmembrane protein from Ralstonia solanacearum (Pseudomonas solanacearum) (801 aa), fasta scores: opt: 131, E(): 1.1, (33.33% identity in 102 aa overlap). Contains a Prosite match to entry PS50310 ALA_RICH Alanine-rich region.

close this sectionSequence

selected fasta
>[hypothetical protein]
MQADETLQVTPPAAESPNVLTGAATVEFAARVPEQSALATAQGAADAVHAASMWAPSVSA
SAGVSQQVPAAAAALAPHGGAVAQCNSQSLAEDLETDTQNAQDLTPHPAVSI
selected fasta
>[hypothetical protein]
ATGCAAGCAGATGAAACGCTGCAGGTCACGCCTCCGGCGGCGGAGTCTCCGAATGTTCTC
ACCGGCGCGGCGACGGTTGAGTTCGCCGCACGTGTGCCCGAGCAATCAGCCCTAGCCACG
GCCCAAGGCGCAGCTGATGCAGTTCATGCTGCCTCGATGTGGGCGCCGAGCGTGTCAGCA
AGCGCGGGAGTCAGCCAGCAGGTGCCTGCGGCCGCAGCGGCGCTGGCACCGCATGGTGGC
GCAGTCGCGCAGTGCAACAGCCAGTCTTTAGCCGAGGACCTCGAGACCGACACTCAAAAT
GCGCAGGACCTCACGCCGCATCCGGCGGTGAGCATATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit