close all open/close all

CDS information : MUP_00760


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction169,158 / 168,487 / - [in whole cluster]
169,158 / 168,487 / - [in contig]
Locationcomplement(168487..169158) [in whole cluster]
complement(168487..169158) [in contig]
TypeCDS
Length672 bp (223 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)possible membrane protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP076c, -, len: 223 aa. Possible membrane protein, contains a membrane spanning region between aa 57 to 79. Contains a Prosite match to entry PS50099 PRO_RICH Proline-rich region.

close this sectionSequence

selected fasta
>[possible membrane protein]
MNPQPVGQHGPPGGPGGWPAPGNGAPNNAAVLAPPAAQVPPPPGPGRLPVSRPRRRGWIA
VGVMLTLAVLMALTAVVMSTIKLTAPAPTATTTTVMAPPPPPTSFSPDQLAAAKKEACHA
SESAATTINTAQEKYLIAARDRQSPTYGPALANFQLVAILETQYMQQHLPPATPNNVVDS
TNGYITAILALADAHTRGLSEDEAQQFVVAARKAGRQLDEACV
selected fasta
>[possible membrane protein]
ATGAATCCGCAGCCAGTGGGCCAGCACGGCCCTCCAGGTGGGCCCGGTGGCTGGCCGGCT
CCCGGTAATGGCGCGCCAAACAATGCCGCGGTGTTGGCGCCGCCTGCGGCTCAGGTTCCG
CCGCCGCCCGGCCCTGGACGGCTGCCTGTGTCCCGACCACGCCGGCGGGGCTGGATTGCG
GTCGGGGTGATGCTGACGCTGGCGGTGCTAATGGCACTTACAGCGGTGGTGATGAGCACG
ATCAAGTTGACCGCGCCGGCCCCGACGGCCACCACAACCACGGTGATGGCGCCGCCGCCA
CCGCCGACAAGCTTTAGCCCCGACCAGCTGGCTGCAGCGAAAAAGGAAGCCTGCCACGCC
AGCGAGTCGGCAGCTACAACAATCAACACAGCACAAGAGAAGTACCTGATCGCTGCGCGC
GACCGGCAATCTCCAACGTACGGGCCAGCATTAGCTAATTTTCAGCTGGTGGCCATCCTA
GAAACGCAGTACATGCAACAACATCTGCCTCCGGCAACTCCCAACAACGTGGTCGACTCG
ACCAACGGCTACATCACGGCGATCCTGGCACTCGCTGACGCGCACACCCGCGGGCTTTCG
GAAGATGAGGCCCAGCAGTTTGTCGTCGCGGCAAGAAAAGCTGGCAGGCAACTCGACGAG
GCGTGTGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM
 [57-79]  Transmembrane (i-o)
Transmembrane 1