close all open/close all

CDS information : MUP_00770


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction169,584 / 169,192 / - [in whole cluster]
169,584 / 169,192 / - [in contig]
Locationcomplement(169192..169584) [in whole cluster]
complement(169192..169584) [in contig]
TypeCDS
Length393 bp (130 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)conserved hypothetical
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP077c, -, len: 130 aa. Conserved hypothetical protein, weakly similar to P71600|Y030_MYCTU|Rv0030 Hypothetical protein from M. tuberculosis (109 aa), fasta scores: opt: 122, E(): 0.42, (27.660% identity in 94 aa overlap); and O69744|Rv3880c Hypothetical protein from M. tuberculosis (115 aa), fasta scores: opt: 112, E(): 2.1, (29.000% identity in 100 aa overlap).

close this sectionSequence

selected fasta
>[conserved hypothetical]
MTVYEYPRYQADKDLTASVVTRLERVSSMLSKVLEEIDGIDVEAIGGDGDVVLSVNAHGQ
LTSLSLAQGCTTRYTHGGLAELINTTLGEAVNAAAAETSAVGEGQDPAALDHAVQAFIDP
DSQVWKPQSR
selected fasta
>[conserved hypothetical]
GTGACGGTTTATGAATATCCGCGGTATCAGGCCGACAAGGATTTGACCGCCAGCGTTGTG
ACACGGCTAGAACGGGTGTCGTCGATGTTGTCGAAGGTGCTCGAAGAAATTGATGGCATT
GACGTCGAAGCTATTGGCGGCGATGGCGATGTGGTGTTGTCGGTCAACGCCCACGGCCAG
CTCACCTCGTTGTCGCTGGCACAGGGATGCACAACGCGCTATACGCACGGGGGGTTGGCA
GAGCTGATCAACACGACATTGGGAGAGGCAGTCAATGCTGCGGCTGCGGAGACGTCGGCC
GTGGGCGAAGGGCAGGACCCGGCCGCGCTTGACCATGCGGTGCAAGCGTTCATCGATCCC
GATAGCCAAGTCTGGAAGCCGCAATCTCGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR024296 Protein of unknown function DUF2710 (Family)
 [9-101]  6.19999999999999e-06 PF10921
PF10921   DUF2710
SignalP No significant hit
TMHMM No significant hit