close all open/close all

CDS information : MUP_00780


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction171,342 / 169,759 / - [in whole cluster]
171,342 / 169,759 / - [in contig]
Locationcomplement(169759..171342) [in whole cluster]
complement(169759..171342) [in contig]
TypeCDS
Length1,584 bp (527 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)conserved hypothetical
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP078c, -, len: 527 aa. Conserved hypothetical protein, weakly similar to Q10691|YK83_MYCTU|Rv2083 Hypothetical protein from M. tuberculosis (314 aa), fasta scores: opt: 229, E(): 0.0041, (32.597% identity in 181 aa overlap); Q8WTL8 Hypothetical 37.7 kDa protein from Caenorhabditis elegans (435 aa), fasta scores: opt: 233, E(): 0.0034, (32.093% identity in 215 aa overlap); and also weakly similar to several PGRS-family proteins e.g. O53884|Rv0872c|PE_PGRS15 PGRS-family protein from M. tuberculosis (606 aa), fasta scores: opt: 220, E(): 0.016, (25.686% identity in 510 aa overlap). Contains a Prosite match to entry PS00029 LEUCINE_ZIPPER Leucine zipper pattern.

close this sectionSequence

selected fasta
>[conserved hypothetical]
MLHVDTAGLQSVAADLGSAASALAGLAAQPLVHPPLATDAVSMSAAARLSGHGAVVASRA
LDGAAVLEAGAQAITQAALGYAAMDEANRAVVSLQGSPGAPTPTLVSAVTADVVAPGVPI
AAPAAQPAETTAAMIEAGRPAAGDGFVSGCAALSKGFREGAVSARSAAIAVSEHLSGQAG
SRISAALNRYADWAQEMAGYAEAVGQHAGDHKSRFGEVKHATPTTSEFTHRHRELQNAIQ
LNSSFPSPGSAAAVSQAHANLVQLTNRTHVVAAGYHTSEIPAAPSGPPPPVSPIVEPGGG
QGDTTTPVPTTQSEQEPNPTESGPDNEGHDERDVDADSDDLDELGVDGELAADPLGAGGA
GSLPGMASAVPAMLTGALGAGVGMAGQIPQKLGQQLQGLAQEATQGMTGLASGLTGAEGV
DIDSEGLDGALGGFGAGSGGGGGLTEPAGAGGVGDVAPAGSAPSGDGFADGIGVAAVDWC
RWRLRCRGACGCRIRGNAADVHAADGRWYGRRWRGRDPQRQRARQIH
selected fasta
>[conserved hypothetical]
GTGCTACACGTCGACACCGCAGGGCTGCAGTCAGTGGCTGCTGATCTGGGCTCCGCGGCA
AGCGCGCTGGCCGGATTGGCTGCGCAGCCACTTGTTCATCCGCCACTGGCCACCGATGCC
GTGTCGATGAGCGCTGCTGCGCGCCTTAGTGGGCATGGCGCGGTGGTGGCCTCGCGTGCC
CTTGATGGGGCTGCCGTCTTGGAGGCGGGAGCCCAAGCGATCACCCAAGCAGCGCTGGGG
TATGCGGCGATGGACGAAGCAAATCGGGCGGTGGTGAGTTTGCAGGGCAGTCCCGGTGCT
CCCACGCCCACGCTGGTGTCTGCGGTGACCGCTGATGTTGTGGCGCCGGGGGTGCCGATC
GCGGCGCCGGCTGCCCAGCCTGCTGAAACCACAGCGGCCATGATCGAAGCGGGCAGGCCC
GCGGCGGGGGATGGGTTTGTGAGCGGGTGCGCGGCGCTGTCGAAGGGCTTTCGTGAGGGT
GCGGTGTCGGCGCGGTCGGCGGCCATCGCGGTCAGTGAACACCTGTCGGGTCAGGCAGGT
TCTCGCATTAGTGCTGCGTTGAATCGCTATGCCGACTGGGCACAGGAAATGGCCGGCTAT
GCCGAAGCGGTGGGTCAGCACGCGGGGGACCACAAGAGCCGTTTCGGTGAGGTCAAGCAT
GCGACGCCTACCACGTCGGAATTCACGCATCGGCATCGCGAGCTGCAAAACGCCATCCAG
CTCAACAGCTCTTTCCCGAGTCCGGGGTCTGCGGCGGCGGTGTCTCAGGCACACGCCAAT
CTCGTCCAGTTGACCAACCGCACCCACGTGGTGGCCGCCGGCTACCACACGAGTGAGATT
CCGGCGGCACCTTCTGGGCCGCCGCCGCCAGTTTCGCCCATTGTTGAACCTGGTGGCGGA
CAAGGGGATACGACGACGCCGGTGCCGACAACTCAGAGCGAGCAAGAACCCAATCCCACC
GAATCCGGCCCAGACAACGAGGGCCACGACGAACGCGACGTCGACGCTGACAGCGACGAC
CTCGACGAGTTGGGGGTCGATGGTGAGTTGGCCGCTGACCCGCTGGGAGCCGGGGGTGCG
GGTTCTCTACCTGGTATGGCCTCAGCGGTGCCAGCGATGCTGACCGGAGCACTGGGCGCC
GGTGTCGGCATGGCCGGCCAAATCCCACAAAAACTTGGTCAGCAGCTGCAAGGGTTGGCT
CAAGAAGCCACGCAAGGGATGACGGGGTTGGCATCGGGATTGACTGGCGCCGAGGGCGTC
GATATCGACTCGGAAGGACTCGACGGCGCGTTGGGTGGTTTTGGTGCTGGCAGCGGCGGT
GGGGGCGGGCTTACCGAGCCTGCCGGCGCAGGTGGTGTCGGTGACGTCGCGCCGGCGGGA
TCGGCGCCGTCGGGGGATGGGTTTGCCGACGGCATCGGCGTCGCCGCGGTTGACTGGTGC
CGGTGGCGTCTCCGGTGCCGCGGTGCCTGCGGTTGCCGGATCCGCGGGAATGCCGCCGAT
GTTCATGCCGCCGATGGGCGCTGGTATGGGCGCAGGTGGCGGGGCCGCGACCCGCAACGT
CAAAGAGCCAGACAAATCCATTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-28]  0.691 Signal
Eukaryota   
 [1-40]  0.321 Signal
Bacteria, Gram-positive   
TMHMM No significant hit