close all open/close all

CDS information : MUP_00790


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction171,660 / 171,361 / - [in whole cluster]
171,660 / 171,361 / - [in contig]
Locationcomplement(171361..171660) [in whole cluster]
complement(171361..171660) [in contig]
TypeCDS
Length300 bp (99 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)conserved hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP079c, -, len: 99 aa. Conserved hypothetical protein, weakly similar to P71598|Y028_MYCTU|Rv0028 Hypothetical protein from M. tuberculosis (101 aa), fasta scores: opt: 93, E(): 11, (32.558% identity in 86 aa overlap); and some similarity to Q51652 DNA primase (Fragment) from Escherichia coli (489 aa), fasta scores: opt: 101, E(): 11, (29.762% identity in 84 aa overlap).

close this sectionSequence

selected fasta
>[conserved hypothetical protein]
MFEARLTDYDTVVFEAASHDESIVVAVGRGGNALGVELQAPAMALTDAELANRIVKLNTL
AHLRSQAALRHEWEAQHVNVSATLPTEDQVAGYEALIDF
selected fasta
>[conserved hypothetical protein]
ATGTTCGAGGCCCGATTGACCGACTACGACACGGTGGTGTTCGAGGCCGCAAGCCATGAT
GAGTCCATTGTGGTTGCGGTGGGCCGAGGCGGCAACGCGTTGGGTGTGGAGCTGCAGGCA
CCGGCGATGGCGCTCACCGACGCCGAGTTGGCCAATCGGATAGTCAAGTTGAACACGCTG
GCTCACCTTCGCTCACAGGCGGCGCTGCGCCACGAGTGGGAGGCCCAGCACGTCAACGTG
TCAGCGACACTGCCGACCGAGGACCAAGTCGCCGGCTATGAAGCCCTGATTGATTTCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit