close all open/close all
MUP_00800 MUP_00800   last last

CDS information : MUP_00810


close this sectionLocation

Organism
StrainAgy99
Entry nameMycolactone
Contig
Start / Stop / Direction173,546 / 172,002 / - [in whole cluster]
173,546 / 172,002 / - [in contig]
Locationcomplement(172002..173546) [in whole cluster]
complement(172002..173546) [in contig]
TypeCDS
Length1,545 bp (514 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)conserved hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • MUP081c, -, len: 514 aa. Conserved hypothetical protein, weakly similar to P71596|YO26_MYCTU|Rv0026 Hypothetical protein from M. tuberculosis (448 aa), fasta scores: opt: 501 E(): 6.9e-15, (31.989% identity in 372 aa overlap). Contains a Prosite match to entry PS00017 ATP_GTP_A- ATP/GTP-binding site motif A (P-loop).

close this sectionSequence

selected fasta
>[conserved hypothetical protein]
MTGWADVVLSEVFGGVSEVLGSPFPQTPSPHDAVSSVPITSTDQLTPLDRAKLTYMGIDP
DSAGLDQINRALGRDQPLSVPPPAAPPPRPTTPAATPPNPDSPELRGAAAEAAKRLDEAL
ARNHSAINDADDQLADAVLKASSSSAEGHQRLQRLQQEIIDEIDKLGSSLDTPAGQQQLA
EFLQGKTGDILNVLKNAGLDSDSQARVLDGLSARYRGLHHDAGSDETPASDGQPQDATTS
SGDAPPSTGDGGEDGLPAADPLLDGLASDPLLSGLGIMAGPAMGALGSLPGALGSAIPSL
GGGGLGGAGLGDLGSALGSALHDGAAPSELDSDEHVEPLTETPQSNPEDDQSPDPTQPAG
LADHGRDHPQLGDSDDAAAPAQPLEASTQVELPDQSVRTAGSSALATAGRAVLAGENIDD
AYAAAQVQLPPPGAPISAPISPGRLQFGDVGQYTDHRVMALDKDHVWLNGQVTPIDQLET
GPNFLGWTRPSTTTSTLTSVTTQPAPLTPATEPS
selected fasta
>[conserved hypothetical protein]
ATGACTGGCTGGGCCGATGTAGTGCTGTCCGAAGTGTTCGGCGGAGTGTCTGAAGTGCTG
GGATCACCTTTCCCGCAGACCCCATCGCCGCATGATGCCGTCTCGTCGGTGCCAATCACC
TCGACAGATCAACTCACGCCGTTGGACCGCGCCAAGCTGACCTACATGGGCATCGACCCA
GATTCAGCGGGACTAGACCAGATCAACCGTGCACTGGGACGTGATCAACCGCTGTCTGTG
CCGCCTCCGGCCGCGCCGCCTCCGCGTCCTACCACCCCAGCGGCGACTCCTCCCAACCCA
GACAGTCCCGAGCTTCGTGGCGCTGCGGCCGAGGCCGCCAAGCGTCTCGACGAAGCTTTA
GCTCGTAACCACTCGGCTATTAATGACGCCGACGACCAACTCGCCGATGCGGTGTTGAAG
GCATCGAGCTCGAGCGCCGAGGGCCACCAGCGTTTGCAGCGCCTCCAGCAAGAAATTATC
GACGAGATCGACAAGCTGGGATCCTCATTGGACACTCCCGCCGGCCAACAGCAGCTCGCC
GAGTTCTTGCAGGGCAAGACCGGCGACATTCTCAACGTGTTGAAAAATGCTGGGTTGGAC
TCTGATTCGCAGGCGCGGGTACTTGATGGCCTGTCAGCGCGCTACCGCGGTCTGCACCAT
GACGCGGGCTCCGACGAGACCCCGGCCAGCGACGGGCAGCCTCAAGACGCCACAACCTCA
TCCGGCGATGCGCCCCCGTCAACGGGCGACGGCGGCGAAGACGGCCTACCGGCAGCTGAT
CCTCTCCTCGACGGACTGGCTTCTGACCCGCTGTTGTCAGGGCTCGGAATCATGGCCGGC
CCGGCGATGGGCGCTTTGGGCTCGTTGCCGGGTGCACTAGGTTCTGCGATTCCATCGTTG
GGCGGCGGTGGGTTGGGAGGGGCCGGTTTGGGCGATCTTGGCTCCGCCCTCGGCAGCGCC
TTACACGACGGCGCAGCGCCTTCCGAGCTGGACTCCGACGAGCACGTTGAACCTCTCACC
GAGACCCCCCAAAGCAACCCCGAAGACGACCAGTCGCCCGATCCAACCCAACCGGCGGGT
CTGGCCGACCACGGTCGCGACCATCCGCAGCTGGGCGATAGCGACGACGCCGCGGCACCG
GCCCAGCCACTGGAGGCATCAACGCAGGTCGAGCTGCCTGATCAATCGGTGCGAACCGCC
GGTAGTAGCGCTTTGGCCACGGCGGGCCGAGCGGTGCTCGCCGGCGAGAACATCGACGAT
GCTTACGCTGCCGCCCAAGTCCAGCTACCCCCACCGGGTGCGCCCATTAGCGCACCGATT
TCCCCGGGCCGGCTGCAGTTCGGCGATGTGGGTCAATACACCGACCATCGGGTCATGGCA
CTAGACAAAGACCACGTTTGGCTCAATGGGCAAGTCACGCCGATCGACCAGCTCGAAACA
GGCCCGAATTTCCTCGGGTGGACACGGCCTTCGACCACGACGTCAACGCTGACCTCAGTC
ACAACGCAGCCGGCACCGCTGACACCGGCCACTGAGCCCAGCTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019710 Protein of unknown function DUF4226 (Family)
 [105-215]  6.6999999999999e-39 PF10774
PF10774   DUF4226
SignalP
 [1-21]  0.284 Signal
Eukaryota   
TMHMM No significant hit
MUP_00800 MUP_00800   last last