close all open/close all
first first   Madu_00020 Madu_00020

CDS information : Madu_00010


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction6,459 / 7,793 / + [in whole cluster]
6,459 / 7,793 / + [in contig]
Location6459..7793 [in whole cluster]
6459..7793 [in contig]
TypeCDS
Length1,335 bp (444 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxygenase
Product (GenBank)dioxygenase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in maduropeptin biosynthesis.
Note (GenBank)
  • mdp orf-5
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q6E4P3
PmId
[15516502] Circadian regulation of the PhCCD1 carotenoid cleavage dioxygenase controls emission of beta-ionone, a fragrance volatile of petunia flowers. (Plant Physiol. , 2004)
ACC
A5HV13
PmId
[17516050] Purification, characterization and gene cloning of isoeugenol-degrading enzyme from Pseudomonas putida IE27. (Arch Microbiol. , 2007)

close this sectionSequence

selected fasta
>putative oxygenase [dioxygenase]
MTQDTGIWLEGHLAPVPDEIDAPDLPVTGTLPPELTGRYFRNGPNPRPGRPSTHWFTGAG
MIHGVRLRAGRAEWYRNRWVRTRELTEDAPFLRDDGTLDLTAVPANTHVVRHAGKILALV
EAGLPHALTPELGTVGLEDFGGRLTTAMTAHPKRDPVTGELLFFGYGVFPPHLTYHRLSA
DGRLLESREIDVPAGTMTHDFAITENHVVWLDLPVVFDLDLAMKETSMPFRWDDAYGARL
GVMPREGGGDVRWFDIDPCYVFHVGNAHEDGAGRIVLDAVRYAPDEFTALWAMIGGSADP
AREAGLLEEARLHRWTLDPATGRAAEEPLDDRGVEFPTHDDDRTGLPNRFLYTVSGNAIV
KYDVRDGSSSAREFEEGASVGEAVFVPAEGARAEDEGWLLSIVSGPSGADLVVMDATDVS
RTTASVRLPRRVPAGFHGSWIPDS
selected fasta
>putative oxygenase [dioxygenase]
ATGACGCAGGACACCGGCATATGGCTTGAAGGACACCTCGCCCCCGTCCCGGACGAGATC
GACGCGCCCGACCTTCCCGTCACCGGCACGCTCCCGCCCGAGCTGACCGGGCGCTACTTC
CGCAACGGCCCCAACCCGCGGCCGGGACGGCCGAGCACCCACTGGTTCACCGGCGCCGGG
ATGATCCACGGCGTGCGGCTCCGCGCGGGCCGGGCCGAGTGGTACCGCAACCGCTGGGTC
CGGACCCGGGAGCTCACCGAGGACGCCCCGTTCCTGCGGGACGACGGGACGCTCGACCTC
ACCGCGGTGCCCGCCAACACCCACGTCGTCCGGCACGCGGGGAAGATCCTCGCGCTCGTC
GAGGCCGGCCTCCCGCACGCGCTGACGCCCGAGCTCGGGACGGTCGGCCTCGAGGACTTC
GGCGGGCGCCTCACCACCGCGATGACCGCGCACCCGAAGCGGGATCCGGTGACGGGCGAG
CTGCTGTTCTTCGGCTACGGCGTCTTCCCGCCCCACCTGACCTACCACCGGCTCTCGGCG
GACGGACGGCTCTTGGAGAGCCGCGAGATCGACGTCCCCGCCGGGACGATGACGCACGAC
TTCGCGATCACCGAGAACCACGTCGTCTGGCTCGACCTGCCCGTCGTCTTCGACCTCGAC
CTGGCGATGAAGGAGACGTCCATGCCGTTCCGCTGGGACGACGCGTACGGGGCGCGGCTC
GGCGTCATGCCCCGGGAGGGTGGCGGGGACGTCCGCTGGTTCGACATCGACCCGTGCTAC
GTGTTCCACGTCGGGAACGCCCACGAGGACGGGGCGGGCCGCATCGTCCTCGACGCCGTG
CGCTACGCCCCCGACGAGTTCACCGCCCTCTGGGCGATGATCGGCGGGTCGGCCGACCCC
GCCCGGGAGGCCGGCCTCCTGGAGGAGGCCCGCCTGCACCGCTGGACGCTCGACCCCGCG
ACCGGACGCGCGGCCGAGGAGCCGCTGGACGACCGGGGCGTGGAGTTCCCCACCCACGAC
GACGACCGGACGGGCCTGCCGAACCGGTTCCTCTACACCGTGTCCGGGAACGCGATCGTG
AAGTACGACGTGCGCGACGGGTCCTCCTCCGCGCGCGAGTTCGAGGAGGGCGCGAGCGTC
GGCGAGGCCGTCTTCGTCCCGGCCGAGGGGGCGCGTGCGGAGGACGAGGGCTGGCTGCTG
TCGATCGTCTCCGGCCCGTCCGGCGCGGATCTCGTGGTCATGGACGCGACGGACGTCTCC
CGGACCACGGCGTCCGTCCGGCTGCCCCGGCGCGTCCCGGCCGGTTTCCACGGAAGCTGG
ATCCCCGACTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004294 Carotenoid oxygenase (Family)
 [11-442]  1.10000000000001e-127 PF03055
PF03055   RPE65
SignalP No significant hit
TMHMM No significant hit
first first   Madu_00020 Madu_00020