close all open/close all

CDS information : Madu_00020


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction9,065 / 7,854 / - [in whole cluster]
9,065 / 7,854 / - [in contig]
Locationcomplement(7854..9065) [in whole cluster]
complement(7854..9065) [in contig]
TypeCDS
Length1,212 bp (403 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxygenase
Product (GenBank)dioxygenase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in maduropeptin biosynthesis.
Note (GenBank)
  • mdp orf-4
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
A5HV13
PmId
[17516050] Purification, characterization and gene cloning of isoeugenol-degrading enzyme from Pseudomonas putida IE27. (Arch Microbiol. , 2007)

close this sectionSequence

selected fasta
>putative oxygenase [dioxygenase]
MMAAETQGTDPRTAPAAAPAHRADAPLPVAGGLPPGLRACFLQAETHPLAPGAGGEILAG
PHLLSGIVLDGGTAWWLRCAPPVGRNRPLGPVPALAPVLWTGAREADPDGPGTVAFARPV
RDPASGRWHTVATYPGLGHAEHLVTAPDGTVVHAEPFPLDGAPLVHAVGLTARYLVVFDL
PVAHSRAAALVGERPPYAWREGRPARVGFLPRAGGAPVTWVPVDPCYVFDVVDARDDGPH
VVLDVVAARRAFDGAGASPSRLRRWRFDPAAGTAAPLRTSAPVTGAVAVPAAEPGAHRLV
ATEPGGTVVLHDPALGTSARTSLGRGWRPGAPVFAPGPETGGWILAVARHAASGRCELRV
LDTSGRPVAAVRLPVRLAAGRAVRSAAVPDAGALAGFAARAAT
selected fasta
>putative oxygenase [dioxygenase]
GTGATGGCCGCCGAGACGCAGGGAACCGATCCGCGGACGGCGCCGGCCGCCGCGCCCGCC
CACCGCGCGGACGCTCCGCTCCCCGTGGCGGGCGGGCTCCCCCCGGGCCTGCGCGCCTGC
TTCCTCCAGGCCGAGACGCACCCGCTGGCGCCCGGCGCGGGCGGCGAGATCCTCGCCGGG
CCGCACCTGCTCTCCGGCATCGTGCTCGACGGCGGGACCGCGTGGTGGCTCCGCTGCGCG
CCGCCCGTCGGGCGGAACCGGCCGCTCGGCCCCGTCCCGGCGCTCGCGCCCGTCCTGTGG
ACGGGCGCGCGGGAGGCGGATCCGGACGGGCCGGGGACGGTCGCGTTCGCGCGTCCGGTC
CGGGACCCGGCGAGCGGCCGGTGGCACACCGTCGCGACCTATCCGGGCCTCGGGCACGCC
GAACACCTGGTCACCGCGCCGGACGGCACCGTCGTCCACGCCGAGCCGTTCCCGCTCGAC
GGCGCTCCGCTCGTCCACGCCGTCGGCCTCACCGCCCGGTACCTCGTCGTGTTCGACCTG
CCCGTGGCCCACTCGCGCGCCGCCGCGCTGGTCGGGGAGCGGCCGCCGTACGCGTGGCGG
GAGGGCCGGCCCGCGCGGGTGGGGTTCCTGCCCCGCGCCGGAGGGGCGCCCGTGACCTGG
GTCCCCGTCGACCCCTGCTACGTCTTCGACGTGGTCGACGCCCGCGACGACGGACCGCAC
GTCGTGCTGGACGTCGTCGCGGCGCGGCGCGCGTTCGACGGAGCGGGCGCGTCCCCGTCC
CGGCTGCGGCGGTGGCGCTTCGACCCCGCCGCCGGGACGGCCGCGCCCCTCCGCACGTCC
GCCCCGGTCACCGGCGCGGTCGCCGTCCCGGCCGCGGAACCGGGCGCGCACCGCCTGGTC
GCGACCGAGCCCGGCGGGACGGTCGTCCTGCACGACCCGGCCCTCGGCACGTCCGCCCGC
ACGTCGCTCGGCCGGGGGTGGCGGCCCGGCGCGCCCGTCTTCGCGCCCGGCCCGGAGACC
GGGGGCTGGATCCTCGCCGTGGCGCGGCACGCCGCGTCCGGACGCTGCGAGCTGCGCGTC
CTCGACACCTCCGGCCGTCCGGTGGCGGCGGTGCGGCTGCCCGTGCGGCTCGCGGCCGGC
CGGGCCGTCCGGTCGGCCGCCGTCCCCGACGCCGGCGCCCTCGCCGGCTTCGCCGCCCGC
GCCGCCACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004294 Carotenoid oxygenase (Family)
 [109-380]  1.69999999999999e-30 PF03055
PF03055   RPE65
SignalP No significant hit
TMHMM No significant hit