close all open/close all

CDS information : Madu_00030


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction9,140 / 9,820 / + [in whole cluster]
9,140 / 9,820 / + [in contig]
Location9140..9820 [in whole cluster]
9140..9820 [in contig]
TypeCDS
Length681 bp (226 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative TetR family transcriptional regulator
Product (GenBank)transcriptional repressor
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in maduropeptin biosynthesis.
Note (GenBank)
  • mdp orf-3
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Family/Domain
FD
IPR001647

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [transcriptional repressor]
MSPRRPDPRARTVLIDVAARLLAEKGPQALTTRRIAAEAGTSTMGVYTHFGSMGELVREM
VREGFARLHTRFTQVRDSDDPVADLALLGRAYRHNALANPHLYAVMFGGASLGGFSLTDE
DRQHGRYTLVYVTACAGRCVEAGRFRPGDPELVAHRMWSAIHGLVTLELGGYLVEPYGAD
TCFESQLVTLMIGAGDTENAATASVTGSAARFDPETGLETGRAPVT
selected fasta
>putative TetR family transcriptional regulator [transcriptional repressor]
ATGAGTCCACGCCGACCTGATCCACGGGCCCGCACCGTCCTGATCGACGTCGCCGCGCGC
CTGCTCGCCGAGAAGGGCCCGCAGGCTCTGACCACGCGCCGCATCGCCGCCGAGGCGGGC
ACCTCGACGATGGGCGTCTACACGCACTTCGGATCGATGGGGGAGCTGGTCCGGGAGATG
GTGCGCGAGGGTTTCGCGCGGCTGCACACCCGGTTCACCCAGGTGCGCGACAGCGACGAT
CCCGTCGCCGACCTGGCGCTGCTGGGCCGCGCCTACCGGCACAACGCCCTGGCCAACCCG
CACCTGTACGCGGTGATGTTCGGCGGCGCCTCGCTCGGCGGCTTCTCCCTGACCGACGAG
GACCGCCAGCACGGCCGCTACACCCTGGTGTACGTGACGGCCTGCGCCGGGCGCTGCGTC
GAGGCGGGACGGTTCCGCCCCGGCGATCCCGAGCTGGTCGCCCACCGGATGTGGAGCGCG
ATCCACGGCCTGGTCACGCTGGAGCTGGGCGGCTACCTCGTCGAGCCCTACGGCGCCGAC
ACGTGCTTCGAGTCCCAGCTCGTCACCCTGATGATCGGGGCGGGCGACACCGAGAACGCC
GCCACGGCGTCCGTCACCGGCTCCGCGGCGCGCTTCGACCCGGAGACCGGCCTGGAGACG
GGGCGGGCCCCGGTCACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [14-27]  3.89999861795218e-06 PR00455 [35-58]  3.89999861795218e-06 PR00455
PR00455   HTHTETR
 [8-68]  PS50977
PS50977   HTH_TETR_2
 [14-60]  3.1e-14 PF00440
PF00440   TetR_N
IPR009057 Homeodomain-like (Domain)
 [4-80]  5.20000089003336e-17 SSF46689
SSF46689   Homeodomain_like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [79-195]  4.80000830876748e-19 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [9-188]  2.59999999999998e-43 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
IPR025996 WHG domain (Domain)
 [88-172]  5.59999999999999e-14 PF13305
PF13305   WHG
SignalP No significant hit
TMHMM No significant hit