close all open/close all

CDS information : Madu_00040


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction11,536 / 9,863 / - [in whole cluster]
11,536 / 9,863 / - [in contig]
Locationcomplement(9863..11536) [in whole cluster]
complement(9863..11536) [in contig]
TypeCDS
Length1,674 bp (557 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative acyl-CoA carboxylase beta subunit
Product (GenBank)methylmalonyl-CoA decarboxylase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in maduropeptin biosynthesis.
Note (GenBank)
  • mdp orf-2
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
O86517
PmId
[11526020] Role of an essential acyl coenzyme A carboxylase in the primary and secondary metabolism of Streptomyces coelicolor A3(2). (Appl Environ Microbiol. , 2001)
[12048195] Kinetic and structural analysis of a new group of Acyl-CoA carboxylases found in Streptomyces coelicolor A3(2). (J Biol Chem. , 2002)
ACC
P53003
PmId
[8830278] Erythromycin production in Saccharopolyspora erythraea does not require a functional propionyl-CoA carboxylase. (Mol Microbiol. , 1996)
ACC
Q9X4K7
PmId
[10589718] Genetic and biochemical characterization of the alpha and beta components of a propionyl-CoA carboxylase complex of Streptomyces coelicolor A3(2). (Microbiology. , 1999)
[12048195] Kinetic and structural analysis of a new group of Acyl-CoA carboxylases found in Streptomyces coelicolor A3(2). (J Biol Chem. , 2002)

close this sectionSequence

selected fasta
>putative acyl-CoA carboxylase beta subunit [methylmalonyl-CoA decarboxylase]
MSTSDLDFVPVAVPRPGTGPAAAPSAPPPGPPAPPSSAPPPARSMRDLRAGRDELRARAA
EGRAEGIERQHGLGKRTARERLELLLDEGSFIEVEMFRRHQAHGLKIGANRPYTDGVVVG
SGTVHGRRVFVYAQDFTVFGGSLGAAHASKIHKVMDLAIANGAPLIGLNDSGGARIQEGV
QALDGYGGIFRRSVQASGVIPQISVVLGPCAGGAAYSPALSDFTFMVRDTAQLYLTGPDV
VEAVSGKRVTHAELGGADVHGDRTGVATFVYDDEETCLEEVRFLLSLLPDNNLEPPPAAP
PRGAADDERPELAEIVPVEPSKPYDMRLVIAELADDGEFMELHERWAANVICALTRIDGE
VAGVVANQPMVLAGVLDADAAQKAARFVRFCDAFRIPLVTLVDVPGFLPGLEQEHAGIIR
HGAKLLYAYCEATVPRVQVILRKAYGGAYIVMDSRSIGCDLSLAWPTNEIAVMGAEGAVN
VLFRRELAAAADPAALRAELIEEYTGQLVHPYYAAERGLVDDVIDPVRTRAVVAGGLRML
RNKRVRTPQRVHGNVPL
selected fasta
>putative acyl-CoA carboxylase beta subunit [methylmalonyl-CoA decarboxylase]
GTGAGCACCTCCGACCTCGATTTCGTCCCGGTCGCGGTACCGCGGCCCGGCACCGGCCCG
GCGGCGGCGCCGTCCGCACCGCCGCCGGGCCCGCCCGCGCCGCCCTCCTCGGCACCGCCG
CCCGCGCGCTCGATGCGGGACCTGCGCGCCGGCCGGGACGAGCTGCGGGCGAGGGCGGCC
GAGGGACGGGCCGAGGGGATCGAGCGGCAGCACGGGCTCGGCAAGCGGACCGCGCGGGAA
CGGCTGGAGCTGCTCCTCGACGAGGGCTCCTTCATCGAGGTCGAGATGTTCCGGCGGCAC
CAGGCGCACGGGCTGAAGATCGGCGCGAACCGCCCGTACACCGACGGGGTGGTCGTCGGA
TCCGGCACGGTCCACGGCCGCCGCGTGTTCGTCTACGCCCAGGACTTCACCGTGTTCGGC
GGCTCGCTGGGCGCCGCGCACGCGTCGAAGATCCACAAGGTGATGGACCTGGCGATCGCG
AACGGGGCCCCGCTGATCGGGCTGAACGACAGCGGGGGCGCGCGGATCCAGGAGGGGGTG
CAGGCGCTCGACGGCTACGGCGGGATCTTCCGCCGCAGCGTCCAGGCGTCCGGCGTGATC
CCGCAGATCAGCGTGGTGCTCGGGCCGTGCGCCGGGGGAGCGGCCTACTCCCCGGCGCTG
AGCGACTTCACGTTCATGGTGCGCGACACCGCCCAGCTGTACCTGACGGGCCCGGACGTG
GTCGAGGCGGTGAGCGGCAAACGGGTCACGCACGCCGAGCTCGGCGGCGCGGACGTGCAC
GGGGACCGGACCGGGGTGGCCACGTTCGTCTACGACGACGAGGAGACCTGCCTGGAGGAG
GTGCGCTTCCTGCTCTCCCTGCTGCCGGACAACAACCTGGAACCGCCGCCCGCCGCGCCT
CCGCGCGGGGCGGCCGACGACGAGCGGCCGGAGCTGGCGGAGATCGTCCCGGTCGAGCCC
AGCAAGCCCTACGACATGCGGCTCGTCATCGCCGAGCTGGCCGACGACGGCGAGTTCATG
GAGCTGCACGAGCGCTGGGCGGCGAACGTGATCTGCGCCCTCACGCGGATCGACGGCGAG
GTCGCGGGCGTGGTCGCGAACCAGCCGATGGTGCTGGCGGGCGTGCTGGACGCCGACGCG
GCGCAGAAGGCCGCGCGGTTCGTCCGGTTCTGCGACGCGTTCCGGATCCCTCTGGTCACG
CTGGTGGACGTGCCCGGGTTCCTGCCCGGCCTGGAGCAGGAGCACGCGGGGATCATCCGG
CACGGTGCCAAGCTGCTGTACGCCTACTGCGAGGCCACGGTGCCGCGCGTCCAGGTCATC
CTGCGCAAGGCGTACGGCGGGGCGTACATCGTCATGGACTCGAGGTCCATCGGGTGCGAC
CTCTCGCTCGCCTGGCCGACGAACGAGATCGCGGTGATGGGCGCCGAGGGCGCCGTGAAC
GTCCTGTTCCGCCGGGAGCTGGCGGCGGCGGCCGATCCCGCCGCCCTGCGCGCCGAACTG
ATCGAGGAGTACACCGGGCAGCTCGTCCATCCGTACTACGCCGCCGAGCGCGGTCTGGTC
GACGACGTCATCGACCCGGTCCGGACCCGTGCCGTCGTCGCCGGGGGGCTGCGGATGCTG
CGGAACAAGCGGGTCCGGACCCCGCAGCGCGTCCACGGGAACGTGCCACTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000022 Carboxyl transferase (Domain)
 [70-554]  PF01039
PF01039   Carboxyl_trans
IPR011762 Acetyl-coenzyme A carboxyltransferase, N-terminal (Domain)
 [50-264]  PS50980
PS50980   COA_CT_NTER
IPR011763 Acetyl-coenzyme A carboxyltransferase, C-terminal (Domain)
 [265-549]  PS50989
PS50989   COA_CT_CTER
SignalP No significant hit
TMHMM No significant hit