close all open/close all

CDS information : Madu_00050


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction11,790 / 12,206 / + [in whole cluster]
11,790 / 12,206 / + [in contig]
Location11790..12206 [in whole cluster]
11790..12206 [in contig]
TypeCDS
Length417 bp (138 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)glyoxylase/dioxygenase superfamily
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in maduropeptin biosynthesis.
Note (GenBank)
  • mdp orf-1
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein [glyoxylase/dioxygenase superfamily]
MNWTLEVVCLPVTDLDRSLAFYSEGLGFNVDIDTVRPDGKRMIQVTPPGSGCSVMLGADM
NDMPPGSMRGLQLVVRDILAAHAELTERGVKVGEVQVFTQDGSMRAYQDGDWLDNTGFLF
FDDPDGNSWAVQQISARD
selected fasta
>hypothetical protein [glyoxylase/dioxygenase superfamily]
ATGAATTGGACGCTCGAGGTCGTCTGCCTTCCGGTCACCGACCTGGACCGCTCCCTCGCC
TTCTACTCCGAGGGGCTCGGCTTCAACGTCGACATCGACACCGTGCGCCCCGACGGGAAG
CGCATGATCCAGGTGACCCCGCCCGGGTCCGGCTGCTCCGTCATGCTGGGCGCCGACATG
AACGACATGCCGCCGGGGTCGATGCGCGGCCTGCAGCTCGTCGTCCGCGACATCCTCGCC
GCCCACGCCGAGCTCACCGAGCGCGGCGTGAAGGTCGGCGAGGTGCAGGTCTTCACGCAG
GACGGCAGCATGCGCGCCTACCAGGACGGCGACTGGCTCGACAACACCGGCTTCCTCTTC
TTCGACGACCCGGACGGCAACAGCTGGGCCGTCCAGCAGATCAGCGCCCGGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR025870 Glyoxalase-like domain (Domain)
 [10-131]  2.2e-14 PF12681
PF12681   Glyoxalase_2
SignalP No significant hit
TMHMM No significant hit