close all open/close all

CDS information : Madu_00060


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction12,362 / 13,396 / + [in whole cluster]
12,362 / 13,396 / + [in contig]
Location12362..13396 [in whole cluster]
12362..13396 [in contig]
TypeCDS
Length1,035 bp (344 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glucose-1-phosphate thymidylyltransferase
putative dTDP-glucose synthase
Product (GenBank)dTDP-1-glucose synthase
Gene
Gene (GenBank)mdpA1
EC number2.7.7.24
Keyword
  • madurose
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q9ZGC8
NITE
Lando_00120
PmId
[16039521] Iteratively acting glycosyltransferases involved in the hexasaccharide biosynthesis of landomycin A. (Chem Biol. , 2005)
ACC
Q8GMI0
NITE
C1027_00100
PmId
[14987060] Biochemical characterization of the SgcA1 alpha-D-glucopyranosyl-1-phosphate thymidylyltransferase from the enediyne antitumor antibiotic C-1027 biosynthetic pathway and overexpression of sgcA1 in Streptomyces globisporus to improve C-1027 production. (J Nat Prod. , 2004)

close this sectionSequence

selected fasta
>putative glucose-1-phosphate thymidylyltransferase [dTDP-1-glucose synthase]
MKALVLAGGTASRLRPFSNSLPKQLIPLAGRPVLEHVLRGIADIGVRDTAIVVGDTAPAV
MDAIGDGARLGLRVTYVPQARPLGLAHCVTLARPFLGDDDFVMYLGDNLLPGGIAGPARR
FRDRRPSAQLLLRRVADPRAFGVAEVGRDGVVRRLEEKPAHPRTDLAVLGVYFFTSAVHA
AIDACRPSHRGELEITDAIQVLIDRGRTVRAVEHTGHWRDIGRPADVLACNRRLLAELRP
RTDGDLDAATEVTGGPVVIEPGARVVRSRITGPALVGADTVLTDCEIGPDAAIGRDCSLR
GVRLRDAVVLDGTSLSGPADVRAALVSPVAAHSVIGAVASGAPG
selected fasta
>putative glucose-1-phosphate thymidylyltransferase [dTDP-1-glucose synthase]
ATGAAAGCTCTGGTGCTGGCGGGGGGCACCGCCTCCCGGCTCCGCCCCTTCAGCAATTCG
CTTCCCAAGCAGCTCATCCCGCTCGCCGGACGCCCGGTCCTGGAACACGTCCTGCGCGGC
ATCGCCGACATCGGCGTCCGGGACACCGCCATCGTGGTGGGCGACACCGCCCCGGCCGTC
ATGGACGCGATCGGCGACGGCGCCCGCCTCGGGCTCCGGGTGACCTACGTCCCGCAGGCC
CGGCCGCTGGGCCTGGCGCACTGCGTCACGCTGGCCCGCCCCTTCCTCGGCGACGACGAC
TTCGTCATGTACCTCGGCGACAACCTGCTGCCGGGCGGCATCGCCGGCCCGGCGCGGCGC
TTCCGCGACCGGCGCCCCAGCGCGCAGCTCCTGCTGCGCCGGGTCGCCGACCCGCGCGCC
TTCGGGGTCGCCGAGGTCGGACGGGACGGCGTCGTCCGGCGGCTCGAGGAGAAGCCCGCG
CACCCGCGCACCGACCTCGCCGTCCTCGGCGTCTACTTCTTCACCTCCGCCGTGCACGCG
GCGATCGACGCCTGCCGCCCGAGCCACCGCGGCGAGCTGGAGATCACCGACGCGATCCAG
GTGCTGATCGACCGGGGCCGCACCGTCCGCGCCGTCGAGCACACCGGCCACTGGCGCGAC
ATCGGGCGGCCCGCGGACGTCCTGGCGTGCAACCGCCGCCTCCTCGCCGAACTGCGGCCC
CGCACGGACGGCGACCTCGACGCGGCCACCGAGGTGACCGGCGGCCCCGTCGTCATCGAA
CCGGGCGCCCGGGTGGTCCGGTCGCGGATCACCGGCCCGGCCCTCGTGGGGGCGGACACC
GTCCTCACCGACTGCGAGATCGGCCCGGACGCCGCCATCGGCCGCGACTGCTCGCTGCGC
GGCGTGCGGCTCCGCGACGCGGTCGTCCTGGACGGCACGTCCCTGTCCGGCCCCGCCGAC
GTCCGCGCCGCCCTCGTCAGTCCGGTCGCCGCGCACAGCGTGATCGGCGCGGTCGCGTCC
GGCGCCCCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [2-235]  4.2e-45 PF00483
PF00483   NTP_transferase
IPR005908 Glucose-1-phosphate thymidylyltransferase, long form (Family)
 [2-317]  1.9e-97 TIGR01208
TIGR01208   RmlA_long
SignalP No significant hit
TMHMM No significant hit