close all open/close all

CDS information : Madu_00090


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction16,169 / 17,389 / + [in whole cluster]
16,169 / 17,389 / + [in contig]
Location16169..17389 [in whole cluster]
16169..17389 [in contig]
TypeCDS
Length1,221 bp (406 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-3 C-methyltransferase
Product (GenBank)C-methyltransferase
Gene
Gene (GenBank)mdpA4
EC number2.1.1.-
Keyword
  • madurose
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
P96561
NITE
Chlor_00150
PmId
[11035791] Deoxysugars in glycopeptide antibiotics: enzymatic synthesis of TDP-L-epivancosamine in chloroeremomycin biosynthesis. (Proc Natl Acad Sci U S A. , 2000)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 C-methyltransferase [C-methyltransferase]
MSDGCKICGGAVRQVLDLGRQPRANAFIPPEEAEREFTFRLALDMCDVCTMVQLHEVVPQ
EMRYHGSYRYHASGSAGHRKHFEGVARDLLRTELAGADPFIVEIGCNDGVMLSTVAESGV
RHLGVDPSANVTALAAERGVRVRTAFFDEGLAEEIRAADGPADVLYGANTVCHIAHLESL
FRGAVRLLKPDGIFVFEEPYLGTILDRTAFDQIYDEHCYYFTARSVQAAAELFGLELVDV
APTPLHGGEIRYTLSPAGARRPSPAVQRMLDAEAVRRLADPATLTQFAHTIAGVRDDLLG
LLREITAAGHTVAGYGAPGKAATATAFFGIGPELVPFVSDSTPAKQGLLVPGSHIPVRPP
EEFRRARPDYALLFAWNHADEIMAKEREFRNAGGRWIRYVPDVHVV
selected fasta
>putative NDP-hexose C-3 C-methyltransferase [C-methyltransferase]
ATGAGCGATGGATGCAAGATATGCGGGGGCGCCGTCCGGCAGGTCCTGGATCTCGGCCGG
CAGCCGAGAGCCAATGCCTTCATCCCGCCCGAAGAGGCCGAACGCGAATTCACCTTCCGG
CTCGCACTGGACATGTGCGACGTCTGCACGATGGTGCAACTGCACGAAGTGGTCCCGCAG
GAAATGCGCTACCACGGCTCGTACCGGTACCACGCGTCGGGCTCGGCCGGGCACCGCAAG
CATTTCGAGGGGGTCGCGCGGGACCTGCTGCGCACGGAACTGGCCGGCGCGGACCCGTTC
ATCGTCGAGATCGGCTGCAACGACGGGGTCATGCTCTCGACGGTCGCCGAGTCCGGCGTC
CGGCATCTCGGCGTCGACCCGTCCGCGAACGTCACCGCGCTGGCGGCGGAGCGCGGCGTG
CGGGTGCGCACCGCCTTCTTCGACGAGGGGCTGGCCGAGGAGATCCGCGCGGCCGACGGT
CCGGCCGACGTCCTCTACGGCGCGAACACCGTCTGCCACATCGCGCACCTGGAGTCGCTC
TTCCGCGGCGCGGTGCGGCTGCTGAAGCCGGACGGGATCTTCGTGTTCGAGGAGCCCTAC
CTCGGGACGATCCTCGACCGGACGGCGTTCGACCAGATCTACGACGAGCACTGCTACTAC
TTCACGGCGAGGTCCGTCCAGGCGGCGGCGGAGCTGTTCGGGCTGGAGCTGGTCGACGTC
GCCCCCACTCCCCTGCACGGCGGCGAGATCCGCTACACGCTGAGCCCGGCCGGGGCACGC
CGCCCGTCCCCCGCCGTGCAGCGGATGCTGGACGCCGAGGCGGTCCGCCGGCTCGCCGAC
CCCGCGACGCTGACGCAGTTCGCCCACACCATCGCCGGGGTGCGCGACGACCTGCTCGGG
CTGCTGCGGGAGATCACCGCCGCCGGGCACACCGTCGCGGGCTACGGGGCGCCCGGCAAG
GCCGCCACCGCGACCGCCTTCTTCGGCATCGGGCCGGAGCTGGTGCCGTTCGTGAGCGAC
TCCACCCCCGCCAAGCAGGGGCTCCTCGTCCCCGGATCGCACATCCCGGTCCGGCCGCCC
GAGGAGTTCAGGCGGGCCCGCCCCGACTACGCGCTGCTGTTCGCGTGGAACCACGCCGAC
GAGATCATGGCGAAGGAGCGCGAGTTCCGGAACGCCGGCGGCCGGTGGATCCGCTACGTG
CCGGACGTCCACGTCGTGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013630 Methyltransferase putative zinc binding domain (Domain)
 [5-62]  3.3e-16 PF08421
PF08421   Methyltransf_13
IPR013691 C-methyltransferase (Domain)
 [244-401]  1.40000000000001e-49 PF08484
PF08484   Methyltransf_14
SignalP No significant hit
TMHMM No significant hit