close all open/close all

CDS information : Madu_00100


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction19,089 / 17,470 / - [in whole cluster]
19,089 / 17,470 / - [in contig]
Locationcomplement(17470..19089) [in whole cluster]
complement(17470..19089) [in contig]
TypeCDS
Length1,620 bp (539 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative FADH2-dependent monooxygenase
Product (GenBank)monooxygenase
GenemdpC
Gene (GenBank)mdpC3
EC number
Keyword
  • two-component system
  • (S)-3-(2-chloro-3-hydroxy-4-methoxyphenyl)-3-hydroxypropionic acid
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q8GMG6
NITE
C1027_00270
PmId
[16104723] Biosynthesis of the beta-amino acid moiety of the enediyne antitumor antibiotic C-1027 featuring beta-amino acyl-S-carrier protein intermediates. (J Am Chem Soc. , 2005)
[18426211] Characterization of the two-component, FAD-dependent monooxygenase SgcC that requires carrier protein-tethered substrates for the biosynthesis of the enediyne antitumor antibiotic C-1027. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative FADH2-dependent monooxygenase [monooxygenase]
MTESPRPPSAEPGAEPGGEPGAPRRRTRPLTGDEYLESLRDGREIHLYGDRVKDVTTHPA
FRNPSRMTARLYDALHDPARRDELTVPTDTGSDGRTHPFFTTPRDSGDLVAAQRAIAGWA
RMSYGWMGRSPDYKGSFLGTLGANAEFYEPFSDNARRWYAEAQEKVLYWNHAIVHPPVDR
NRPPDEVADVFVHVERETDAGLVVSGAKVVATASALTHHTFLAHYGLPVRKREFALIATV
PMDAPGLKLICRPSYSAAAAVMGSPFDYPLSSRLDENDTILVLDKVLIPWENVFVYGDLG
KVQMFTARSGFPERFTFHGCTRLAVKLDFLAGLLTKAVELTGTAGFRGVQTRLGEVLAWR
NLFWGLSDAAARTPVPWKDGSVLPNPDYGMAYRWFMQLGYPRIREIALQDVASGLIYVNS
SAEDFADPEVRPYLDKYLRGSGGADSVERVKLMKLLWDAVGSEFGGRHELYERNYAGNHE
NTRVELLAAQTVGGQLDAYKAFVDECLAEYDLDGWRVPDLDSFPGLRGLRDRLAEGGGA
selected fasta
>putative FADH2-dependent monooxygenase [monooxygenase]
ATGACCGAGAGCCCACGACCGCCGTCCGCGGAGCCCGGTGCGGAGCCCGGCGGGGAGCCC
GGTGCGCCGCGGCGCCGGACGCGTCCCCTCACCGGGGACGAGTACCTGGAGTCGCTGCGC
GACGGGCGGGAGATCCACCTGTACGGCGACCGCGTCAAGGACGTCACGACCCATCCGGCG
TTCCGCAACCCGAGCCGGATGACGGCGCGGCTGTACGACGCGCTCCACGATCCCGCGCGG
CGGGACGAGCTGACCGTCCCGACCGACACCGGCTCCGACGGCCGCACCCATCCGTTCTTC
ACCACCCCGCGCGACTCCGGCGACCTGGTCGCGGCGCAGCGGGCCATCGCGGGGTGGGCG
CGGATGAGCTACGGCTGGATGGGCCGCAGCCCCGACTACAAGGGGTCGTTCCTCGGCACG
CTGGGCGCGAACGCCGAGTTCTACGAGCCGTTCTCCGACAACGCCCGCCGCTGGTACGCC
GAGGCCCAGGAGAAGGTGCTGTACTGGAACCACGCGATCGTCCATCCGCCGGTCGACCGG
AACCGCCCGCCCGACGAGGTCGCGGACGTGTTCGTCCACGTGGAGCGGGAGACCGACGCC
GGGCTGGTGGTCAGCGGGGCGAAGGTCGTGGCCACCGCCTCCGCGCTGACCCACCACACC
TTCCTGGCGCACTACGGGCTGCCGGTACGCAAGCGGGAGTTCGCGCTCATCGCGACGGTG
CCGATGGACGCGCCGGGGCTGAAGCTGATCTGCCGGCCGTCGTACTCGGCCGCGGCGGCG
GTCATGGGCTCGCCGTTCGACTACCCGCTCTCCTCGCGGCTGGACGAGAACGACACCATC
CTCGTCCTGGACAAGGTCCTCATCCCCTGGGAGAACGTCTTCGTCTACGGCGACCTGGGC
AAGGTGCAGATGTTCACGGCGCGGTCGGGGTTCCCGGAGCGCTTCACCTTCCACGGCTGC
ACCCGGCTGGCCGTGAAGCTGGACTTCCTGGCGGGGCTGCTGACGAAGGCGGTGGAGCTG
ACCGGGACGGCCGGGTTCCGCGGCGTCCAGACCCGCCTGGGCGAGGTGCTGGCCTGGCGG
AACCTGTTCTGGGGGCTGTCGGACGCCGCCGCCCGCACGCCCGTCCCGTGGAAGGACGGC
TCGGTGCTCCCGAACCCCGACTACGGCATGGCGTACCGGTGGTTCATGCAGCTCGGCTAT
CCGCGGATCAGGGAGATCGCGCTCCAGGACGTCGCCAGCGGGCTGATCTACGTCAACTCC
AGCGCCGAGGACTTCGCCGACCCCGAGGTCCGGCCGTACCTCGACAAGTACCTGCGCGGG
TCGGGGGGCGCGGACTCGGTGGAGCGCGTCAAGCTGATGAAGCTGCTCTGGGACGCGGTG
GGCTCGGAGTTCGGCGGACGGCACGAGCTGTACGAGCGCAACTACGCGGGGAACCACGAG
AACACCCGGGTGGAGCTGCTGGCGGCCCAGACCGTCGGGGGGCAGCTGGACGCCTACAAG
GCGTTCGTCGACGAGTGCCTGGCCGAGTACGACCTGGACGGCTGGCGGGTGCCGGACCTG
GACTCGTTCCCCGGCCTCCGCGGCCTGCGCGACCGTCTCGCCGAAGGCGGCGGAGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004925 HpaB/PvcC/4-BUDH (Family)
 [11-523]  PIRSF000331
PIRSF000331   HpaA_HpaB
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [168-292]  1.99999999999999e-47 G3DSA:2.40.110.10
G3DSA:2.40.110.10   Acyl_CoA_DH/ox_M
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [293-504]  1.29999999999998e-41 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
 [286-510]  5.8999880940569e-56 SSF47203
SSF47203   AcylCoADH_C_like
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [28-296]  3.699978135861e-79 SSF56645
SSF56645   AcylCoA_dehyd_NM
IPR024674 HpaB/PvcC/4-BUDH N-terminal (Domain)
 [31-295]  6.7999999999999e-100 PF11794
PF11794   HpaB_N
IPR024677 4-HPA 3-monooxygenase large component/Pyoverdin chromophore biosynthetic protein (Family)
 [11-534]  PIRSF500125
PIRSF500125   4_HPA_large
IPR024719 HpaB/PvcC/4-BUDH C-terminal (Domain)
 [302-504]  4.09999999999995e-74 PF03241
PF03241   HpaB
SignalP No significant hit
TMHMM No significant hit