close all open/close all

CDS information : Madu_00110


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction20,092 / 19,106 / - [in whole cluster]
20,092 / 19,106 / - [in contig]
Locationcomplement(19106..20092) [in whole cluster]
complement(19106..20092) [in contig]
TypeCDS
Length987 bp (328 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative UDP-glucuronic acid decarboxylase
Product (GenBank)glucuronic acid decarboxylase
Gene
Gene (GenBank)mdpA3
EC number
Keyword
  • madurose
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q8KNF5
NITE
Calm_00420
PmId
[19290519] Characterization of CalS9 in the biosynthesis of UDP-xylose and the production of xylosyl-attached hybrid compound. (Appl Microbiol Biotechnol. , 2009)
[26289554] Characterization of Early Enzymes Involved in TDP-Aminodideoxypentose Biosynthesis en Route to Indolocarbazole AT2433. (Chembiochem. , 2015)
ACC
Q0H2W2
PmId
[26289554] Characterization of Early Enzymes Involved in TDP-Aminodideoxypentose Biosynthesis en Route to Indolocarbazole AT2433. (Chembiochem. , 2015)

close this sectionSequence

selected fasta
>putative UDP-glucuronic acid decarboxylase [glucuronic acid decarboxylase]
MERALVTGGSGFIGAHLVDRLVARGDEVTVFDAVPSRDGRGSPREHARHVTGDVRAADAL
AEVIKPGVDVVYHLAAIVGVDRYLTRPLDVIDINVLGTRNVLELAARAGARVLVASTSEV
FGKNPAVPWGEDGDRVLGPTTADRWTYSSSKALAEHMTFAFGRQHGLESRVVRFFNVYGP
RQRPAYIVSRSVHRALNGVPPVVYDRGGQTRCFTYVDDAVEGALLAAGNPAAAGYAFNIG
TTDETTVAEVVALVNKLAGVEATPLQVDTAEKLGPVYEDLPRRVPDTVRAAGLLGWRPGT
GLEDGLTRTIEWARANPWWLSLPDQGAT
selected fasta
>putative UDP-glucuronic acid decarboxylase [glucuronic acid decarboxylase]
ATGGAACGCGCGCTCGTCACGGGCGGCTCGGGGTTCATCGGCGCGCACCTGGTCGACCGG
CTGGTCGCCCGGGGCGACGAGGTGACCGTCTTCGACGCGGTGCCGTCCAGGGACGGCCGC
GGCTCGCCCCGGGAGCACGCCCGCCACGTCACCGGGGACGTCCGCGCCGCCGACGCGCTG
GCCGAGGTGATCAAGCCCGGGGTCGACGTCGTCTACCACCTGGCCGCCATCGTCGGCGTC
GACCGGTACCTCACCCGGCCGCTGGACGTCATCGACATCAACGTGCTCGGCACCCGCAAC
GTGCTGGAGCTGGCGGCCCGCGCGGGCGCCCGGGTGCTGGTCGCCAGCACCAGCGAGGTC
TTCGGCAAGAACCCGGCGGTGCCGTGGGGGGAGGACGGCGACCGGGTGCTCGGCCCGACC
ACGGCCGACCGGTGGACCTACTCGTCCAGCAAGGCGCTCGCCGAGCACATGACGTTCGCG
TTCGGGCGCCAGCACGGGCTGGAGTCCCGGGTGGTGCGCTTCTTCAACGTGTACGGGCCC
CGGCAGCGTCCGGCCTACATCGTCAGCCGCAGCGTGCACCGCGCGCTCAACGGCGTCCCG
CCCGTCGTGTACGACCGGGGCGGGCAGACGCGCTGCTTCACCTACGTGGACGACGCGGTG
GAGGGGGCGCTGCTGGCCGCCGGGAACCCGGCGGCGGCCGGGTACGCGTTCAACATCGGC
ACCACGGACGAGACGACGGTCGCCGAGGTCGTCGCGCTGGTCAACAAGCTCGCCGGGGTC
GAGGCCACGCCCTTGCAGGTGGACACGGCCGAGAAGCTCGGGCCCGTCTACGAGGACCTG
CCGCGCCGGGTGCCCGACACCGTCCGGGCCGCCGGCCTGCTCGGCTGGCGTCCCGGCACC
GGGCTGGAGGACGGCCTGACCAGGACGATCGAGTGGGCGCGGGCGAACCCGTGGTGGCTG
AGCCTGCCGGACCAGGGCGCCACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [4-240]  3.99999999999998e-53 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [2-173]  4.30000000000003e-45 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit