close all open/close all

CDS information : Madu_00120


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction21,438 / 20,095 / - [in whole cluster]
21,438 / 20,095 / - [in contig]
Locationcomplement(20095..21438) [in whole cluster]
complement(20095..21438) [in contig]
TypeCDS
Length1,344 bp (447 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-alpha-D-glucose dehydrogenase
Product (GenBank)NDP glucose dehydrogenase
Gene
Gene (GenBank)mdpA2
EC number1.1.1.-
Keyword
  • madurose
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q8KNF6
NITE
Calm_00410
PmId
[12404643] On the origin of deoxypentoses: evidence to support a glucose progenitor in the biosynthesis of calicheamicin. (Chembiochem. , 2002)
[26240141] Structural Characterization of CalS8, a TDP-alpha-D-Glucose Dehydrogenase Involved in Calicheamicin Aminodideoxypentose Biosynthesis. (J Biol Chem. , 2015)
ACC
Q0H2W3
PmId
[26289554] Characterization of Early Enzymes Involved in TDP-Aminodideoxypentose Biosynthesis en Route to Indolocarbazole AT2433. (Chembiochem. , 2015)

close this sectionSequence

selected fasta
>putative NDP-alpha-D-glucose dehydrogenase [NDP glucose dehydrogenase]
MPDNQPDPGTVAVVGLGYVGSCLAAALAERGLNVLGIDTDEQLIDEYNAGFCRFREDMLA
DGIARALAAGRLHLTTDHRAVSRAGVVLIAVGTPVHADGSLADGQLRAACGALGEHLRPG
QLAVLKSTVPPGTTRELVRPLLEQGGLRAGRDFRLAFSPERLAEGTALTELRSFPIVVGG
IDARSTAEAAEFWRRGLGVATVPQESLEAAELVKLADNWWIDLNIALANELARLCALYGA
DVLDVIEAANTVPKGNGHVNILLPGVGVGGSCLTKDPWMVWHAARLRGLELHTPRAGRAA
NSAMPEYTAQLIIDDLLECGKDPAESTVAVLGLAFKNDTGDLRATPTQGVIAALTKAGVR
VRCHDPLVDADAAEDLLNVRPLPTVEETVRDADCLAVLAHHRAFDAIEYAALEPAGSCLI
LDGRDHFPKDKVAKLRELGYRYRGIGR
selected fasta
>putative NDP-alpha-D-glucose dehydrogenase [NDP glucose dehydrogenase]
GTGCCGGACAACCAGCCGGACCCGGGGACCGTCGCGGTCGTCGGGCTCGGGTACGTGGGG
TCGTGCCTCGCGGCGGCCCTGGCCGAGCGCGGCCTGAACGTCCTCGGGATCGACACCGAC
GAGCAGCTCATCGACGAGTACAACGCGGGCTTCTGCAGGTTCCGCGAGGACATGCTGGCG
GACGGCATCGCCCGCGCGCTGGCGGCGGGCAGGCTGCACCTGACCACCGACCACCGGGCC
GTGTCCCGGGCCGGCGTGGTGCTGATCGCCGTCGGCACGCCCGTCCACGCCGACGGGTCG
CTGGCCGACGGGCAGCTCCGCGCCGCCTGCGGGGCGCTCGGCGAGCACCTGCGCCCCGGC
CAGCTCGCGGTGCTCAAGAGCACCGTCCCGCCGGGCACCACCCGGGAGCTGGTGCGGCCG
CTGCTGGAGCAGGGCGGCCTGCGGGCGGGCCGGGACTTCCGGCTGGCCTTCAGCCCGGAA
CGGCTCGCGGAGGGGACGGCGCTCACCGAACTGCGCTCGTTCCCCATCGTGGTCGGCGGA
ATCGACGCGCGCAGCACCGCGGAGGCGGCGGAGTTCTGGCGGCGGGGCCTGGGCGTGGCG
ACGGTCCCGCAGGAGTCGCTGGAGGCCGCGGAGCTGGTCAAGCTCGCCGACAACTGGTGG
ATCGACCTGAACATCGCCCTCGCCAACGAGCTGGCCAGGCTGTGCGCGCTGTACGGCGCG
GACGTCCTGGACGTGATCGAGGCGGCCAACACCGTCCCCAAGGGCAACGGCCACGTCAAC
ATCCTGCTGCCCGGCGTCGGGGTCGGGGGGTCGTGCCTGACCAAGGACCCGTGGATGGTG
TGGCACGCGGCCCGCCTGCGCGGGCTGGAGCTGCACACGCCCCGTGCCGGCCGCGCGGCC
AACTCGGCGATGCCGGAGTACACCGCGCAGCTGATCATCGACGACCTGCTCGAGTGCGGC
AAGGACCCCGCCGAGTCCACGGTCGCGGTGCTGGGGCTGGCGTTCAAGAACGACACCGGG
GACCTGCGCGCCACCCCGACCCAGGGCGTCATCGCGGCCCTGACGAAGGCCGGGGTGCGG
GTGCGCTGCCACGATCCGCTGGTCGACGCCGACGCGGCCGAGGACCTGCTGAACGTCCGG
CCGCTGCCCACGGTGGAGGAGACCGTCCGGGACGCCGACTGCCTGGCGGTCCTGGCCCAC
CACCGCGCGTTCGACGCGATCGAGTACGCCGCGCTGGAGCCGGCCGGGTCGTGCCTGATC
CTGGACGGCCGCGACCACTTCCCGAAGGACAAGGTCGCGAAGCTCCGCGAGCTCGGCTAC
CGCTACCGCGGAATCGGGAGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001732 UDP-glucose/GDP-mannose dehydrogenase, N-terminal (Domain)
 [10-189]  3.80000000000003e-41 PF03721
PF03721   UDPG_MGDP_dh_N
IPR008927 6-phosphogluconate dehydrogenase, C-terminal-like (Domain)
 [207-304]  2.70000183580794e-28 SSF48179
SSF48179   6DGDH_C_like
IPR014026 UDP-glucose/GDP-mannose dehydrogenase, dimerisation (Domain)
 [208-304]  9.29999999999998e-22 PF00984
PF00984   UDPG_MGDP_dh
IPR014027 UDP-glucose/GDP-mannose dehydrogenase, C-terminal (Domain)
 [313-440]  1.79999754022375e-26 SSF52413
SSF52413   UDP-Glc/GDP-Man_DH_C
 [329-429]  3.00000067992871e-25 SM00984
SM00984   UDPG_MGDP_dh_C
 [329-425]  8.80000000000003e-20 PF03720
PF03720   UDPG_MGDP_dh_C
IPR016040 NAD(P)-binding domain (Domain)
 [10-229]  1.6e-53 G3DSA:3.40.50.720 [239-447]  9.40000000000003e-46 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR017476 Nucleotide sugar dehydrogenase (Family)
 [1-447]  3.89999861795218e-111 PIRSF000124
PIRSF000124   UDPglc_GDPman_dh
 [10-424]  6.40000000000004e-107 TIGR03026
TIGR03026   NDP-sugDHase
SignalP No significant hit
TMHMM No significant hit