close all open/close all

CDS information : Madu_00130


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction22,661 / 21,450 / - [in whole cluster]
22,661 / 21,450 / - [in contig]
Locationcomplement(21450..22661) [in whole cluster]
complement(21450..22661) [in contig]
TypeCDS
Length1,212 bp (403 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 aminotransferase
Product (GenBank)aminotransferase
Gene
Gene (GenBank)mdpA5
EC number2.6.1.-
Keyword
  • madurose
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q9ALN9
NITE
Spino_00040
PmId
[15913355] Characterization of protein encoded by spnR from the spinosyn gene cluster of Saccharopolyspora spinosa: mechanistic implications for forosamine biosynthesis. (J Am Chem Soc. , 2005)
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 aminotransferase [aminotransferase]
MTMNGGGPAHRAGPSGPMINVFQPALGDAELAAVKEVFDSNWIGRGRRADAFETAFARHI
GVGRAHVTSVNSCTEATFIAMDLAGVGPGDEVVLPTVSFVGVGNAVASRGARPVFCDVDP
RTLAPTVDAVAGALTERTRAVVVLHYGGYPGDIARIAALCRDRGVLLIEDAAIGIASSVD
GRACGTFGDFGVWSFDHGKIAVAVDGGMLYVRDPELAARAPKLAYLGLEQKSGFDQALHR
DTRWWEFEVSDFARRSVTNDVLAAVGNVQLGRLPGFIDRRREVARRYDAGLAGVAGLDRP
PPLPPGHESSYYMYWVQFEGGIRDQIARDLYDRGIYTTFRYPPLHLVKAYGSDAVLPDAE
AAAARTLLLPMHQSLTDTDVERVVDAVRTCVPARLRERDRAVT
selected fasta
>putative NDP-hexose C-4 aminotransferase [aminotransferase]
ATGACGATGAACGGTGGCGGGCCGGCCCACCGGGCCGGCCCGTCCGGCCCGATGATCAAC
GTTTTCCAGCCGGCGCTGGGAGACGCGGAGCTGGCGGCGGTCAAGGAGGTCTTCGACAGC
AACTGGATCGGCCGCGGGAGGCGGGCCGACGCGTTCGAGACCGCGTTCGCGCGCCACATC
GGGGTGGGACGCGCGCACGTCACGTCGGTCAACTCGTGCACCGAGGCGACCTTCATCGCG
ATGGACCTGGCGGGCGTCGGGCCCGGCGACGAGGTCGTCCTGCCGACGGTGAGCTTCGTC
GGGGTCGGCAACGCCGTCGCGTCCCGCGGCGCCCGCCCGGTCTTCTGCGACGTCGACCCG
CGGACGCTCGCCCCCACGGTCGACGCCGTCGCGGGGGCGCTGACCGAACGCACCCGGGCG
GTGGTCGTCCTGCACTACGGCGGCTACCCGGGCGACATCGCGCGGATCGCCGCGCTGTGC
CGCGACCGGGGCGTCCTGCTGATCGAGGACGCGGCCATCGGCATTGCCTCCTCGGTCGAC
GGGCGCGCCTGCGGGACGTTCGGCGACTTCGGGGTGTGGAGCTTCGACCACGGCAAGATC
GCCGTGGCGGTCGACGGCGGAATGCTGTACGTCCGCGACCCCGAGCTGGCGGCGCGCGCG
CCCAAGCTCGCCTACCTCGGCCTGGAGCAGAAGAGCGGCTTCGACCAGGCCCTCCACCGC
GACACCCGGTGGTGGGAGTTCGAGGTGTCCGACTTCGCCCGGCGCTCGGTCACCAACGAC
GTGCTCGCCGCCGTCGGGAACGTCCAGCTGGGACGGCTCCCCGGGTTCATCGACCGCAGG
CGGGAGGTCGCGCGGCGCTACGACGCGGGCCTCGCCGGCGTGGCCGGGCTGGACCGCCCG
CCGCCGCTGCCGCCGGGGCACGAGTCGTCCTACTACATGTACTGGGTGCAGTTCGAGGGA
GGGATCAGGGACCAGATCGCCCGCGACCTGTACGACCGGGGCATCTACACCACCTTCCGC
TACCCGCCGCTCCACCTGGTCAAGGCGTACGGCTCGGACGCGGTGCTCCCGGACGCGGAG
GCGGCGGCCGCCCGCACCCTGTTGCTGCCCATGCACCAGTCGCTCACCGACACGGACGTG
GAGCGGGTCGTCGACGCCGTGCGCACGTGCGTCCCCGCACGTCTGCGGGAACGCGACCGC
GCGGTGACATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [1-395]  3.99998544139379e-71 PIRSF000390
PIRSF000390   PLP_StrS
 [26-388]  4.80000000000003e-86 PF01041
PF01041   DegT_DnrJ_EryC1
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [19-271]  3.29999999999997e-62 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [274-391]  3.7e-31 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [15-395]  1.59998835313644e-84 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit