close all open/close all

CDS information : Madu_00140


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction23,104 / 22,658 / - [in whole cluster]
23,104 / 22,658 / - [in contig]
Locationcomplement(22658..23104) [in whole cluster]
complement(22658..23104) [in contig]
TypeCDS
Length447 bp (148 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)mdpJ
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MTKSDAAAPSASDPAAVAALTQRVVAAWAHQDAEGFAGVFTDDGTMILPGVYRKGRDEIR
AYMADAFAGQYKGTQVTGKPLDMKFLAADTALLLTQGGVLAAGESEVSDEQAIRASWLAV
KRDGEWRLTAYQNSPSVQTLPTPGASAK
selected fasta
>hypothetical protein [unknown]
ATGACCAAGTCCGACGCCGCCGCGCCGTCCGCATCCGACCCGGCGGCCGTGGCCGCCCTC
ACCCAGCGCGTCGTCGCCGCCTGGGCCCACCAGGACGCCGAGGGGTTCGCCGGGGTCTTC
ACCGACGACGGCACGATGATCCTGCCGGGCGTGTACCGCAAGGGCCGCGACGAGATCCGC
GCCTACATGGCGGACGCGTTCGCGGGCCAGTACAAGGGCACCCAGGTCACCGGCAAGCCG
CTCGACATGAAGTTCCTCGCCGCGGACACGGCGCTCCTGCTCACCCAGGGCGGGGTGCTG
GCCGCCGGGGAGTCGGAGGTCTCCGACGAGCAGGCCATCCGGGCGTCGTGGCTCGCGGTG
AAGCGGGACGGCGAGTGGCGCCTCACCGCCTACCAGAACAGCCCCTCCGTGCAGACGCTG
CCCACGCCGGGGGCCTCGGCGAAATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011944 Steroid delta5-4-isomerase (Family)
 [13-135]  2.4e-40 TIGR02246
TIGR02246   TIGR02246
SignalP No significant hit
TMHMM No significant hit