close all open/close all

CDS information : Madu_00150


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction24,329 / 23,145 / - [in whole cluster]
24,329 / 23,145 / - [in contig]
Locationcomplement(23145..24329) [in whole cluster]
complement(23145..24329) [in contig]
TypeCDS
Length1,185 bp (394 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)oxidoreductase
Gene
Gene (GenBank)mdpD2
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q6PV90
PmId
[15357313] Molecular cloning and identification of a novel oxygenase gene specifically induced during the growth of Rhodococcus sp. strain T104 on limonene. (J Microbiol. , 2004)

close this sectionSequence

selected fasta
>putative oxidoreductase [oxidoreductase]
MVSTSAVPTRKELVARAAELAPVLRSNSAWSEKNRRLHDESVQALADAGLFRMRMPARYG
GYECDTRTLVEVAAELGRADGSAAWVASVYWIPGWMTCLFPDEVQDEVFSTPDVRVCGTL
SPSAIAKPVDGGVVVTGKWGFISGAHHAEWQEIIAILTPEDGEPYPVMGLVPLSELLVVD
DWNTSGLRGTGSISTVARDLFVPQERVLPLPAVLQGQPASARNAGTPIYRVPLLPVASAS
SVGAVLGMAYAARDAFHKRLPGRKITYTGYESQRDATITHLQIAEATMKTDEAEFHAYRL
ADLVDAKAAEGTPWKLEERAQVRADLGAVCRLAKEAVDVLASASGGSSIYEDVPIQRILR
DVQAVNQHALMNPNTNTELYGRVLCGLEPNTLYI
selected fasta
>putative oxidoreductase [oxidoreductase]
ATGGTGTCGACCAGTGCGGTCCCCACCCGGAAAGAACTCGTCGCGCGGGCGGCCGAATTG
GCGCCGGTCCTGCGCTCCAACAGTGCCTGGTCGGAGAAGAACCGGCGGTTGCACGACGAG
TCGGTCCAGGCGCTCGCCGACGCGGGACTGTTCAGAATGCGCATGCCCGCCCGGTACGGG
GGCTACGAGTGCGACACCCGGACGCTGGTCGAGGTGGCCGCCGAACTGGGGCGCGCCGAC
GGCTCCGCCGCGTGGGTGGCGTCGGTGTACTGGATCCCCGGGTGGATGACGTGCCTGTTC
CCCGACGAGGTCCAGGACGAGGTGTTCTCGACCCCCGACGTGCGGGTGTGCGGAACGCTG
AGCCCGAGCGCGATCGCCAAGCCGGTGGACGGCGGCGTCGTCGTCACCGGCAAGTGGGGC
TTCATCAGCGGCGCCCACCACGCCGAGTGGCAGGAGATCATCGCGATCCTGACGCCCGAG
GACGGCGAGCCGTACCCGGTGATGGGGCTGGTCCCCCTGTCGGAGCTGCTGGTCGTGGAC
GACTGGAACACCTCGGGGCTGCGCGGCACGGGCAGCATCAGCACGGTCGCCCGGGACCTG
TTCGTCCCGCAGGAGCGGGTCCTGCCGCTGCCGGCCGTCCTGCAGGGGCAGCCGGCGTCC
GCGCGCAACGCCGGGACGCCGATCTACCGGGTGCCGCTGCTGCCCGTCGCGTCCGCCTCG
TCGGTCGGTGCCGTGCTGGGGATGGCGTACGCGGCCCGCGACGCCTTCCACAAGCGCCTT
CCCGGCCGCAAGATCACCTACACCGGGTACGAGAGCCAGCGCGACGCGACGATCACGCAC
CTGCAGATCGCCGAGGCGACGATGAAGACCGACGAGGCGGAGTTCCACGCCTACCGGCTC
GCGGACCTGGTCGACGCCAAGGCCGCCGAGGGCACGCCCTGGAAGCTGGAGGAACGCGCG
CAGGTCCGGGCGGACCTCGGCGCCGTCTGCCGCCTCGCCAAGGAGGCCGTGGACGTCCTG
GCCTCCGCCAGCGGCGGATCGTCGATCTACGAGGACGTGCCGATCCAGCGGATCCTCCGC
GACGTCCAGGCCGTCAACCAGCACGCCCTGATGAACCCGAACACCAACACCGAGCTCTAC
GGCCGCGTGCTGTGCGGCCTCGAGCCCAACACGCTCTACATCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [117-202]  4.29999999999998e-23 G3DSA:2.40.110.10
G3DSA:2.40.110.10   Acyl_CoA_DH/ox_M
IPR006092 Acyl-CoA dehydrogenase, N-terminal (Domain)
 [13-89]  3.2e-08 PF02771
PF02771   Acyl-CoA_dh_N
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [203-390]  2.1e-40 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
 [223-388]  1.19999985703101e-08 SSF47203
SSF47203   AcylCoADH_C_like
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [1-210]  1.40000506907309e-34 SSF56645
SSF56645   AcylCoA_dehyd_NM
IPR013107 Acyl-CoA dehydrogenase, type 2, C-terminal (Domain)
 [241-373]  6.79999999999998e-30 PF08028
PF08028   Acyl-CoA_dh_2
IPR013786 Acyl-CoA dehydrogenase/oxidase, N-terminal (Domain)
 [5-112]  2.99999999999998e-38 G3DSA:1.10.540.10
G3DSA:1.10.540.10   AcylCoA_DH/ox_N
SignalP No significant hit
TMHMM No significant hit