close all open/close all

CDS information : Madu_00160


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction24,584 / 25,630 / + [in whole cluster]
24,584 / 25,630 / + [in contig]
Location24584..25630 [in whole cluster]
24584..25630 [in contig]
TypeCDS
Length1,047 bp (348 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Product6-methylsalicylyl-CoA C-3 C-methyltransferase
Product (GenBank)C-methyltransferase
Gene
Gene (GenBank)mdpB1
EC number2.1.1.-
Keyword
  • 3,6-dimethylsalicylic acid
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
[20718468] Enediyne antitumor antibiotic maduropeptin biosynthesis featuring a C-methyltransferase that acts on a CoA-tethered aromatic substrate. (J Am Chem Soc. , 2010)
Related Reference
ACC
C0JWB3
NITE
Polk_00180
PmId
[19266534] Organisation of the biosynthetic gene cluster and tailoring enzymes in the biosynthesis of the tetracyclic quinone glycoside antibiotic polyketomycin. (Chembiochem. , 2009)

close this sectionSequence

selected fasta
>6-methylsalicylyl-CoA C-3 C-methyltransferase [C-methyltransferase]
MVDSRTVTVSEADYLRLIIHGTTAFELLRTALEFELFELLETAGGMDVAETAAALGVDEQ
PARILLLGLTSMKLLERREDGYANSAVARDRLLRSGRRFLGPLVDVQAEVINRALPDFAE
AMRRNTNVGLRHITGPGTTLYERLTAHPDLQRIFYANMGDASRYAFAQLLDLYDFSGVRH
VLDLGGGDGTNSLHLARRRPGLEATVFDQESVVRLAADRIEDPDLRKRVHFHAGDLFADP
FPDGCDAILYFHIFEIWSLERNTELLRKCHAALPEGGVCVVYNFTSDDAGTGPMSAGLVS
PYFLTLASGEGMAYAPDDMERAVRDAGFSRVDRRQDLGFGHTLVVGRK
selected fasta
>6-methylsalicylyl-CoA C-3 C-methyltransferase [C-methyltransferase]
ATGGTCGACAGTCGCACCGTCACCGTCTCCGAGGCAGACTATCTACGCCTCATCATTCAC
GGCACGACCGCCTTCGAATTGCTTCGCACCGCTCTGGAATTCGAGCTCTTCGAGCTGCTC
GAGACGGCCGGTGGAATGGACGTCGCGGAGACGGCGGCGGCGCTCGGCGTCGACGAGCAG
CCGGCCCGCATCCTGCTGCTGGGCCTGACCTCGATGAAGCTGCTGGAGCGGCGCGAGGAC
GGCTACGCCAACAGCGCCGTGGCCCGGGACCGGCTGCTGCGGTCCGGACGCCGCTTCCTC
GGCCCGCTCGTCGACGTGCAGGCCGAGGTCATCAACCGGGCCCTCCCCGACTTCGCCGAG
GCGATGCGCCGGAACACCAACGTGGGCCTGCGCCACATCACCGGCCCCGGGACGACGCTG
TACGAGCGGCTCACCGCGCACCCGGACCTGCAGCGGATCTTCTACGCCAACATGGGGGAC
GCGTCCCGGTACGCCTTCGCCCAGCTCCTCGACCTGTACGACTTCTCCGGCGTCCGGCAC
GTCCTGGACCTCGGCGGCGGCGACGGCACCAACAGCCTCCACCTGGCCCGGCGCCGTCCC
GGGCTCGAGGCGACGGTGTTCGACCAGGAGAGCGTGGTGCGCCTGGCCGCCGACCGGATC
GAGGACCCGGACCTGCGCAAGCGCGTCCACTTCCACGCCGGCGACCTGTTCGCCGACCCG
TTCCCGGACGGCTGCGACGCGATCCTGTACTTCCACATCTTCGAGATCTGGTCGCTGGAG
CGGAACACCGAGCTGCTGCGCAAGTGCCACGCGGCGCTGCCCGAGGGGGGCGTGTGCGTG
GTCTACAACTTCACGTCCGACGACGCCGGCACCGGCCCGATGAGCGCCGGGCTCGTGTCC
CCGTACTTCCTCACCCTCGCCTCGGGCGAAGGCATGGCCTACGCGCCGGACGACATGGAG
CGGGCCGTCCGGGACGCGGGCTTCTCCCGCGTCGACCGCCGCCAGGACCTCGGTTTCGGC
CACACGCTCGTCGTCGGCCGCAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [108-296]  3.90000000000001e-32 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [13-88]  3.2e-11 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016461 O-methyltransferase, caffeic acid-type (Family)
 [1-347]  1.90000068477872e-08 PIRSF005739
PIRSF005739   O-mtase
SignalP No significant hit
TMHMM No significant hit