close all open/close all

CDS information : Madu_00170


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction25,704 / 30,947 / + [in whole cluster]
25,704 / 30,947 / + [in contig]
Location25704..30947 [in whole cluster]
25704..30947 [in contig]
TypeCDS
Length5,244 bp (1,747 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
putative 6-methylsalicylic acid synthase
Product (GenBank)6-methylsalicylic acid synthase
Gene
Gene (GenBank)mdpB
EC number2.3.1.165
Keyword
  • iterative
  • 3,6-dimethylsalicylic acid
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
Related Reference
ACC
Q0R4P8
NITE
Chth_00060
PmId
[16793515] Genetic characterization of the chlorothricin gene cluster as a model for spirotetronate antibiotic biosynthesis. (Chem Biol. , 2006)
[16677607] Cloning and characterization of a bacterial iterative type I polyketide synthase gene encoding the 6-methylsalicyclic acid synthase. (Biochem Biophys Res Commun. , 2006)
[20534347] Insights into bacterial 6-methylsalicylic acid synthase and its engineering to orsellinic acid synthase for spirotetronate generation. (Chem Biol. , 2010)
[26833898] Insights into 6-Methylsalicylic Acid Bio-assembly by Using Chemical Probes. (Angew Chem Int Ed Engl. , 2016)
ACC
P87162
PmId
[20304931] Hidden function of catalytic domain in 6-methylsalicylic acid synthase for product release. (J Biol Chem. , 2010)
ACC
P22367
PmId
[26833898] Insights into 6-Methylsalicylic Acid Bio-assembly by Using Chemical Probes. (Angew Chem Int Ed Engl. , 2016)

close this sectionPKS/NRPS Module

B1 acetyl-CoA
malonyl-CoA
KS5..379
AT547..862
TH870..1016
KR1379..1571
ACP1667..1731

close this sectionSequence

selected fasta
>polyketide synthase [6-methylsalicylic acid synthase]
MNSPEPIAIVGMACRFAGGVGSPAEFWDLLRTGGDAVGELPAGRWDGYAARDQEHADAVR
DVTRRGAFLDDVEGFDADFFDITPREAELLDPQQRIMLELAWEALEHAGIPPADLAGSDA
GVFVGVGSDDYGRRLLEDLPRIEAWTGIGGSYCGVANRVSYTLDLRGPSMAVDTACSSSL
VSIHLAAQALRAGECPVALAGGVLVMAAPGLSMVLDAAGALAPDGRSKSFDAAADGYGRG
EGGGFVVLKRLADARRDGDRVLAVLRGSAVHQDGRTNGIMAPSGEAQIHLMRRACRAAGI
DPAEVGYVEAHGTGTRVGDPIEAAALGTVFAEGRPADRPLLIGSVKPNVGHLEAGAGVAG
VIKTVLALQHGEIPPSPHIGTPNPAIAWDELRLRAVTGPVAWPDTGGPRLAGVSGYGYGG
TIAHLLLEAGDPPVPADAADAGGTGETGAADARLAVYPLSAADPAALARHAGRLADRLSR
PGAPGTADTGFTLARRRPRLPHRAAVVAGNRAELVERLRELAAGGQDAGTAAAPTGSVLP
GAERGPVWVFSGQGSQWTGMGRELLAEEPVFAEVIERLEPVFRAELDVSPRAVLLDDAPR
PTSVVQPMIFAMQVALAAVWRAHGVRPGAVIGHSVGEIAAAVTTGVLSLEEGAALVCRRS
VLLRRLEGRGAMAMVALPPEEAERRLAGRRDVAVAVAASPGSAVLSGDAAAMRELTERWS
AQGVRIRPVDSDVAFHSPQADPLCAPLAAAAAGLRPRPPRLPLYTTALDDPRDDAPRDGA
YWAANLRAPVRFAAAVAAAAEDGYTVFLEVSPHPVVEHSIVETLDAHGVTDHLVAHTLRR
ARPERAALLANLGLLSCHGAEVDWSACWPGGAPADLPATPWRHRPYWAAAPEGGTPVTGR
HDPAGHTLLGGRTRMNGTTPAHAWLTRVDRASRPYPGEHPVREVEIVPAAVLLTTFLTAA
AATAGWSDLADVALRVPVSLTRPRDVQVVLQDGTLRLSSRMADGDPDDKGWVTHTTAAVE
PYSDPAPDGGPVAAGTPLPPSHVVDRLGALGVAGMGFPWTVERIRAGEGVLALTVRAGDA
AGPGDPAKATWAPILDAAMSAGSVALPDPPTLRMPARLHRLSLPPAPPVRADLVIRVTGE
NTVDVDILAPEGGTLGTLTGLRYGELDGEVGAVANPRRLVHEITWRAPDGAAGRAAEPSG
VVLVGPRSALRDALAEGLARTGTPHRVASSPSGLRDAAGESPGEVLVVPRPGRPGRVEQD
AGAATRLLARTVRTLAAGTGRASRLWCVTQGVRECAGPAPLGHAPLWGLARIIGAEHPDL
WGGVIDVDGVPDVPAVLDVLRGTGGEDVVAVRDGGLLVPRLRFPEGDPVRAPISCRPDGT
YLITGGLGVLGLEVAQWLAARGARRLVLAGRRTLPPRDSWDELTDPADVARVRAIRSLER
LGVTVVVVTVDVADAETAGKLLSPAALGLPPIRGVVHAAGVVDNRLLRDLDGESLRAVQR
PKIGGALVLHSLFPPGEPDFFVLFSSCGQLLGLPGQGAYAASNAFLDGLAAHRRNAGDTG
TISFGWTSWRGLGMSRSSAVIDEELAARGTADISRAEAFQAWELAERYDLGYAAVLRTIP
LDPGRRRPPLFDDLPAEPAADAGAAAAAAPWAGLHGPELRDFLHAEITRRVAAETGLGAS
DVDPGRPLVEMGVDSVMTVRIRRGLERGLRRPLPATLFWDRPTVEAVAEFLADGLDAAGS
AVEEASA
selected fasta
>polyketide synthase [6-methylsalicylic acid synthase]
ATGAACTCCCCCGAACCCATCGCCATCGTCGGGATGGCATGCCGCTTCGCCGGGGGCGTC
GGGTCGCCGGCCGAGTTCTGGGATCTGCTGCGCACCGGCGGCGACGCCGTCGGGGAACTG
CCCGCGGGCCGCTGGGACGGGTACGCCGCCCGCGACCAGGAGCACGCGGACGCGGTGCGC
GACGTGACCAGGCGCGGTGCGTTCCTCGACGATGTCGAGGGCTTCGACGCCGACTTCTTC
GACATCACCCCGCGCGAGGCGGAACTGCTCGACCCGCAGCAGCGGATCATGCTGGAGCTG
GCCTGGGAGGCGCTGGAGCACGCCGGGATCCCGCCCGCGGACCTCGCCGGTTCGGACGCG
GGCGTGTTCGTGGGAGTCGGCTCCGACGACTACGGCCGGCGGCTGCTCGAGGACCTGCCC
CGCATCGAGGCGTGGACGGGCATCGGCGGCTCGTACTGCGGGGTCGCCAACCGCGTGTCG
TACACGCTGGACCTGCGCGGCCCCAGCATGGCGGTGGACACCGCGTGCTCCTCGTCCCTC
GTGTCGATCCATCTGGCCGCGCAGGCGCTGCGCGCGGGCGAGTGCCCGGTGGCCCTCGCG
GGCGGCGTCCTGGTCATGGCCGCGCCGGGGCTGTCGATGGTGCTGGACGCGGCGGGGGCG
CTGGCCCCCGACGGGCGCAGCAAGTCCTTCGACGCCGCCGCCGACGGCTACGGCCGCGGG
GAGGGCGGCGGGTTCGTCGTGCTCAAGCGGCTGGCGGACGCGCGGCGCGACGGCGACCGG
GTGCTCGCGGTGCTGCGCGGCAGCGCCGTCCACCAGGACGGCCGCACCAACGGCATCATG
GCGCCGAGCGGCGAGGCCCAGATCCACCTGATGCGGCGCGCCTGCCGGGCCGCCGGAATC
GACCCGGCCGAGGTCGGCTACGTGGAGGCCCACGGGACCGGGACGCGGGTCGGCGACCCG
ATCGAGGCGGCGGCGCTCGGCACGGTGTTCGCCGAGGGCCGTCCCGCCGACCGTCCGCTG
CTGATCGGCTCGGTCAAGCCCAACGTCGGGCACCTGGAGGCCGGGGCGGGCGTGGCCGGG
GTGATCAAGACGGTGCTGGCCCTCCAGCACGGCGAGATCCCGCCGAGCCCGCACATCGGC
ACACCGAATCCCGCGATCGCGTGGGACGAGCTGCGGCTGCGCGCGGTCACCGGGCCGGTC
GCGTGGCCGGACACCGGCGGCCCGCGGCTGGCGGGCGTCTCGGGCTACGGCTACGGCGGC
ACGATCGCGCACCTCCTGCTGGAGGCCGGGGACCCGCCCGTCCCGGCCGACGCCGCCGAC
GCCGGCGGCACCGGCGAGACCGGCGCGGCGGACGCCCGCCTCGCGGTCTACCCGCTGTCG
GCCGCCGATCCGGCCGCGCTCGCCCGGCACGCCGGACGGCTGGCCGACCGGCTGTCGCGG
CCCGGCGCCCCCGGCACGGCCGACACCGGGTTCACGCTGGCCCGCCGCCGCCCCCGGCTG
CCCCACCGCGCCGCGGTCGTCGCCGGGAACCGCGCCGAGCTGGTCGAACGGCTCCGGGAG
CTCGCCGCGGGCGGGCAGGACGCCGGCACCGCCGCGGCCCCGACCGGGTCGGTGCTGCCG
GGCGCCGAGCGCGGTCCGGTCTGGGTGTTCTCCGGGCAGGGCTCGCAGTGGACCGGCATG
GGGCGCGAGCTGCTCGCCGAGGAGCCGGTGTTCGCCGAGGTCATCGAGCGGCTCGAACCG
GTCTTCCGCGCCGAGCTGGACGTGTCGCCGCGGGCCGTGCTGCTGGACGACGCCCCGCGG
CCCACCTCGGTCGTGCAGCCGATGATCTTCGCGATGCAGGTGGCGCTCGCGGCGGTGTGG
CGGGCGCACGGGGTGCGTCCGGGCGCCGTCATCGGCCACTCGGTCGGGGAGATCGCCGCG
GCCGTGACCACCGGGGTGCTCTCCCTGGAGGAGGGCGCCGCGCTCGTCTGTCGCCGGTCG
GTGCTGCTGCGCCGGCTGGAGGGGCGCGGCGCGATGGCGATGGTCGCGCTGCCGCCGGAG
GAGGCCGAACGCCGCCTCGCCGGCCGCCGCGACGTCGCCGTCGCCGTCGCCGCGTCCCCC
GGCTCGGCCGTCCTGTCCGGTGACGCCGCCGCGATGCGGGAGCTCACCGAGCGGTGGAGC
GCGCAGGGGGTGCGGATCCGTCCGGTGGACTCCGATGTCGCGTTCCACAGCCCGCAGGCC
GACCCGCTGTGCGCCCCGCTGGCCGCCGCGGCGGCCGGGCTGCGGCCCCGCCCGCCGCGG
CTCCCGCTCTACACGACCGCGCTGGACGACCCCAGGGACGACGCGCCCCGGGACGGCGCG
TACTGGGCCGCGAACCTGCGCGCCCCCGTCCGGTTCGCCGCCGCCGTGGCGGCCGCCGCC
GAGGACGGGTACACGGTGTTCCTGGAGGTCTCCCCGCATCCGGTGGTGGAGCACTCCATC
GTCGAGACGCTCGACGCGCACGGCGTCACGGACCACCTCGTGGCCCATACGCTGCGCCGC
GCGCGGCCCGAACGCGCGGCCCTGCTCGCCAATCTGGGGCTGCTGAGCTGCCACGGCGCG
GAGGTGGACTGGTCCGCGTGCTGGCCCGGCGGCGCACCCGCCGACCTGCCCGCGACGCCC
TGGCGGCACCGGCCGTACTGGGCGGCGGCCCCCGAGGGCGGGACCCCGGTCACCGGACGG
CACGATCCCGCCGGGCACACGCTGCTCGGCGGCCGGACCAGGATGAACGGCACCACCCCC
GCGCACGCCTGGCTCACCCGGGTCGACCGGGCGTCCCGCCCCTACCCGGGCGAGCACCCG
GTCCGCGAGGTGGAGATCGTCCCGGCGGCGGTGCTGCTGACCACCTTCCTGACCGCGGCG
GCGGCGACGGCCGGGTGGTCGGACCTGGCCGACGTGGCGCTGCGGGTGCCGGTCAGCCTG
ACCCGTCCCCGCGACGTCCAGGTCGTCCTCCAGGACGGCACGCTGCGGCTGTCGTCCCGG
ATGGCCGACGGCGACCCGGACGACAAGGGCTGGGTCACCCACACGACGGCGGCCGTCGAA
CCGTACTCCGACCCGGCGCCGGACGGCGGGCCGGTCGCGGCGGGCACCCCGCTGCCCCCG
AGCCACGTGGTCGACCGGCTCGGCGCGCTCGGCGTCGCGGGCATGGGCTTCCCCTGGACG
GTGGAGCGGATCCGGGCGGGCGAGGGCGTCCTGGCCCTCACCGTGCGGGCGGGGGACGCG
GCGGGTCCGGGCGACCCGGCGAAGGCGACGTGGGCGCCGATCCTGGACGCCGCGATGTCG
GCCGGATCCGTCGCGCTCCCCGATCCCCCGACCCTGCGGATGCCCGCCCGGCTCCACCGG
CTGTCGCTGCCGCCGGCCCCGCCCGTCCGGGCCGACCTCGTGATCCGGGTGACCGGCGAG
AACACGGTGGACGTGGACATCCTCGCCCCCGAGGGCGGAACGCTGGGCACGCTGACCGGG
CTGCGCTACGGCGAGCTGGACGGGGAGGTCGGGGCGGTCGCCAACCCGCGCCGGCTCGTC
CACGAGATCACCTGGCGGGCGCCCGACGGCGCCGCGGGCCGCGCCGCCGAGCCGTCCGGC
GTGGTGCTGGTGGGCCCGCGCAGCGCCCTGCGCGACGCCCTCGCCGAGGGGCTCGCCCGG
ACCGGGACGCCGCACCGGGTGGCGTCCTCGCCGAGCGGGCTCCGGGACGCCGCCGGGGAG
TCGCCCGGCGAGGTGCTGGTGGTGCCGCGGCCCGGCCGTCCCGGCCGGGTGGAGCAGGAC
GCGGGCGCCGCGACCCGCCTGCTGGCGCGCACGGTCCGGACGCTCGCGGCGGGCACCGGC
CGCGCGTCCCGGCTGTGGTGCGTCACCCAGGGCGTCCGGGAGTGCGCCGGCCCGGCCCCG
CTCGGCCACGCGCCGCTGTGGGGGCTGGCCCGGATCATCGGCGCGGAGCACCCCGACCTG
TGGGGCGGCGTCATCGACGTCGACGGCGTCCCGGACGTGCCCGCGGTCCTCGACGTGCTG
CGCGGGACCGGCGGCGAGGACGTCGTCGCGGTCCGCGACGGCGGCCTCCTGGTGCCGCGG
CTGCGGTTCCCGGAGGGCGACCCCGTCCGCGCGCCGATCAGCTGCCGGCCCGACGGCACC
TACCTGATCACCGGCGGGCTCGGCGTCCTCGGCCTGGAGGTCGCGCAGTGGCTGGCGGCC
CGCGGCGCCCGGCGCCTGGTGCTGGCCGGACGCCGGACGCTGCCGCCCCGCGACTCCTGG
GACGAGCTCACCGACCCGGCCGACGTGGCGCGGGTGCGGGCGATCCGGTCGCTGGAGCGG
CTCGGCGTCACCGTGGTCGTCGTCACGGTGGACGTCGCGGACGCGGAGACGGCGGGCAAG
CTGCTGTCGCCCGCCGCGCTGGGGCTGCCGCCCATCCGCGGCGTCGTGCACGCCGCCGGG
GTGGTCGACAACCGGCTGCTGCGCGACCTGGACGGCGAGTCGCTGCGCGCCGTCCAGCGG
CCCAAGATCGGCGGCGCGCTGGTGCTGCACTCGCTGTTCCCGCCGGGCGAACCGGACTTC
TTCGTGCTGTTCTCCTCCTGCGGGCAGCTCCTCGGGCTGCCCGGCCAGGGCGCCTACGCG
GCGAGCAACGCGTTCCTGGACGGGCTGGCGGCCCACCGGCGCAACGCCGGCGACACCGGG
ACGATCAGTTTCGGCTGGACCTCGTGGCGCGGCCTCGGCATGTCGCGGTCGTCCGCCGTC
ATCGACGAGGAGCTGGCCGCCCGCGGCACGGCCGACATCAGCCGCGCCGAGGCGTTCCAG
GCGTGGGAGCTGGCCGAACGGTACGACCTCGGGTACGCCGCCGTCCTGCGCACGATCCCG
CTGGACCCCGGCCGGCGGCGGCCGCCGCTGTTCGACGACCTGCCCGCCGAGCCCGCCGCC
GACGCCGGGGCCGCGGCCGCGGCGGCCCCCTGGGCGGGGCTGCACGGGCCGGAGCTGCGG
GACTTCCTGCACGCCGAGATCACCCGCCGGGTCGCCGCGGAGACCGGGCTCGGCGCGTCC
GACGTCGACCCCGGCCGGCCGCTGGTCGAGATGGGCGTCGACTCGGTGATGACCGTCCGG
ATCCGCCGCGGGCTGGAGCGCGGCCTGCGCCGGCCGCTGCCCGCGACCCTGTTCTGGGAC
CGGCCCACCGTCGAGGCGGTCGCCGAGTTCCTCGCCGACGGCCTCGACGCCGCCGGGTCC
GCCGTCGAGGAGGCGAGCGCATGA
[1] KS5..379
[1] AT547..862
[1] acetyl-CoA malonyl-CoA733..737
[1] TH870..1016
[1] KR1379..1571
[1] ACP1667..1731
[1] KS13..1137
[1] AT1639..2586
[1] acetyl-CoA malonyl-CoA2197..2211
[1] TH2608..3048
[1] KR4135..4713
[1] ACP4999..5193

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [545-666]  1.2e-64 G3DSA:3.40.366.10 [733-850]  1.2e-64 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1690-1705]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1667-1731]  2.7e-07 PF00550
PF00550   PP-binding
 [1663-1732]  PS50075
PS50075   ACP_DOMAIN
 [1654-1739]  2.39999798157265e-15 SSF47336
SSF47336   ACP_like
 [1661-1733]  6.90000000000001e-14 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [1379-1571]  1.99999999999999e-57 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [5-254]  1.5e-87 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [262-379]  4.5e-44 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [547-862]  1.79999999999997e-94 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [545-842]  5.00000909915354e-60 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [668-732]  3.39999972437717e-13 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [5-264]  4.49999999999996e-91 G3DSA:3.40.47.10 [266-429]  3.80000000000003e-60 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [1-432]  1.19999063421924e-99 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1379-1575]  6.1e-29 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [167-183]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [549-842]  1.09999184471405e-94 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1664-1735]  1.10000150671642e-21 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [7-432]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1379-1572]  1.99999636034521e-52 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit