close all open/close all

CDS information : Madu_00180


close this sectionLocation

Organism
StrainATCC 39144
Entry nameMaduropeptin
Contig
Start / Stop / Direction30,944 / 32,590 / + [in whole cluster]
30,944 / 32,590 / + [in contig]
Location30944..32590 [in whole cluster]
30944..32590 [in contig]
TypeCDS
Length1,647 bp (548 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Product6-methylsalicylic acid--CoA ligase
6-methylsalicylyl-CoA synthetase
Product (GenBank)CoA ligase
Gene
Gene (GenBank)mdpB2
EC number
Keyword
  • 3,6-dimethylsalicylic acid
Note
Note (GenBank)
Reference
ACC
PmId
[17918933] Characterization of the maduropeptin biosynthetic gene cluster from Actinomadura madurae ATCC 39144 supporting a unifying paradigm for enediyne biosynthesis. (J Am Chem Soc. , 2007)
[20718468] Enediyne antitumor antibiotic maduropeptin biosynthesis featuring a C-methyltransferase that acts on a CoA-tethered aromatic substrate. (J Am Chem Soc. , 2010)

close this sectionSequence

selected fasta
>6-methylsalicylic acid--CoA ligase [CoA ligase]
MTSIPRMIPWPAEAAARYRAAGCWLGRPLGEHMWRWADNWGDRVAVVDGDVRLTFRDLAV
RADALARGLAERGLGRGDTVLVQLPNRWDFVVTALACFRLGVAPVMMLPPHREYELTSIG
RHVAAKALIVPDRWRGFDHRALAHRVAAALPEPPLVVVMGGGPHPGDVAGHELILRDGDV
AGRRRWLDERAPDPGDVALFLLSGGTTGVPKLINRTHDDYEYNMRCSAAACGFGPGTVYL
AVLPVGHNFPLASPGVFGALSSGGRAVLLPSPRSDAVFAAIEAERVTTTSAVPAVALAWA
EAAGTTRRDLSSLRHVHVGGSMLSPEVAATIGPALGCRLQQVYGMAEGLICYTRPDAPDE
IAHATQGTPVSPHDELLVVDHDGRPVPAGAIGELLTRGPYTPRGYFGAPVQNRESFTPDG
WYRTGDLVRITAEGNVVVCGRSKDLINRAGEKIAAGEIETLVQELPQVAEAAAVAVPDPA
VGERVCLVVRLHPGHALTLAEVAGALTARGLAAFKIPERLEILDRLPHTPVGKPDKPALR
DLVTAPTR
selected fasta
>6-methylsalicylic acid--CoA ligase [CoA ligase]
ATGACCAGCATTCCGCGCATGATCCCCTGGCCCGCCGAGGCGGCCGCCCGCTACCGGGCG
GCGGGCTGCTGGCTGGGCCGCCCGCTGGGCGAGCACATGTGGCGCTGGGCGGACAACTGG
GGCGACCGGGTCGCCGTGGTCGACGGCGACGTCCGGCTGACGTTCCGCGACCTGGCGGTC
CGGGCCGACGCGCTCGCCCGCGGGCTCGCCGAGCGCGGCCTCGGGCGCGGCGACACCGTC
CTCGTCCAGCTCCCCAACCGCTGGGACTTCGTCGTGACGGCGCTGGCCTGCTTCCGGCTC
GGCGTCGCGCCGGTCATGATGCTGCCGCCGCACCGCGAGTACGAGCTGACCTCCATCGGA
CGGCACGTCGCGGCCAAGGCGCTGATCGTCCCCGACCGGTGGCGCGGCTTCGACCACCGG
GCGCTCGCGCACCGGGTCGCCGCCGCGCTGCCGGAGCCGCCGCTGGTGGTGGTCATGGGC
GGCGGCCCGCACCCCGGGGACGTCGCCGGGCACGAGCTGATCCTGCGGGACGGCGACGTC
GCCGGGCGGCGGCGCTGGCTGGACGAGCGGGCGCCCGATCCGGGCGACGTGGCGCTGTTC
CTGCTGTCGGGCGGCACCACGGGCGTGCCCAAGCTCATCAACCGGACGCACGACGACTAC
GAGTATAACATGCGGTGCAGCGCCGCGGCCTGCGGTTTCGGCCCCGGCACCGTCTACCTG
GCGGTACTGCCGGTCGGGCACAACTTCCCGCTGGCCAGCCCGGGGGTGTTCGGGGCGCTG
TCGTCCGGCGGACGGGCGGTGCTGCTGCCCTCGCCGCGGTCCGACGCGGTCTTCGCCGCG
ATCGAGGCGGAGCGCGTGACGACGACCTCGGCCGTCCCGGCGGTCGCGCTGGCGTGGGCG
GAGGCGGCCGGGACGACCCGGCGCGACCTGTCCAGCCTGCGGCACGTCCACGTCGGCGGC
TCGATGCTGTCGCCCGAGGTGGCCGCGACCATCGGCCCCGCGCTGGGCTGCCGGCTGCAG
CAGGTCTACGGCATGGCCGAGGGCCTCATCTGCTACACGCGGCCGGACGCCCCCGACGAG
ATCGCCCACGCGACGCAGGGGACGCCCGTCAGCCCGCACGACGAACTGCTCGTCGTGGAC
CACGACGGCCGTCCCGTCCCGGCCGGCGCGATCGGCGAGCTGCTCACCCGCGGCCCGTAC
ACGCCGCGCGGGTACTTCGGGGCGCCCGTCCAGAACCGCGAGTCGTTCACCCCGGACGGC
TGGTACCGCACCGGCGACCTGGTGCGGATCACCGCCGAGGGGAACGTCGTGGTGTGCGGG
CGCAGCAAGGACCTGATCAACCGGGCCGGGGAGAAGATCGCCGCCGGTGAGATCGAGACC
CTGGTCCAGGAGCTGCCGCAGGTGGCCGAGGCCGCCGCGGTGGCGGTGCCGGACCCGGCC
GTCGGCGAGCGGGTCTGCCTGGTCGTCCGGCTGCACCCCGGGCACGCCCTGACGCTGGCG
GAAGTGGCCGGAGCGCTCACCGCGCGCGGCCTCGCCGCCTTCAAGATCCCCGAGCGCCTG
GAGATCCTGGACCGGCTCCCGCACACGCCCGTCGGCAAGCCCGACAAGCCGGCGCTCCGC
GACCTCGTCACCGCCCCGACCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [54-472]  4.89999999999996e-92 PF00501
PF00501   AMP-binding
IPR020845 AMP-binding, conserved site (Conserved_site)
 [200-211]  PS00455
PS00455   AMP_BINDING
IPR025110 Domain of unknown function DUF4009 (Domain)
 [514-543]  5e-05 PF13193
PF13193   DUF4009
SignalP No significant hit
TMHMM No significant hit